SecReT4
Protein ID: 315123601
T4SS name [ID]VirB [413]
Gene symbol-
Locus tagICDCCJ07001_pTet000023
StrainCampylobacter jejuni subsp. jejuni ICDCCJ07001
Repliconplasmid pTet [GenBank: NC_014801] [Browse all T4SS(s) in this replicon]
Location [Strand]30124..30786 [+]
ProductcmgB8
Component typeVirB8
UniProt IDE6S1C0
KEGG IDcjn:ICDCCJ_pTet000023
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.3e-60, Aligned region: 9..217
Protein Sequence: 220 a.a.     [Download]
>gi|315123601|ref|YP_004065606.1| cmgB8 [Campylobacter jejuni subsp. jejuni ICDCCJ07001]
MKNEFNTAIDYEASFRYLIEKSNKRAWLIAFISIFIAIISIIAVVLLTPLKTIEPYVIRVDNTTGMVDIL
TMLDEKEIKANEALDKYFISTYVKAREGYYYDLLNQDYLLTQLMSSEKVANEYRALYEGDNARDQILKNS
NEVSVQILSIVLGESNGVKTATVRAIITTKNLTSKGTTQATKVITLSYDYILAKASEENRFLNPLGFKVL
TYRIDDEVAQ
 
Nucleotide Sequence: 663 bp     [Download]
>gi|315123578|ref|NC_014801.1|:30124-30786 Campylobacter jejuni subsp. jejuni ICDCCJ07001 plasmid pTet, complete sequence
ATGAAAAATGAGTTTAATACTGCAATAGATTATGAAGCAAGTTTTAGATACTTAATTGAAAAAAGTAATA
AAAGAGCTTGGCTTATTGCTTTTATTTCTATTTTTATAGCCATTATTTCCATTATAGCTGTTGTTTTACT
TACTCCTTTAAAAACAATAGAACCTTATGTAATAAGAGTAGACAATACTACAGGAATGGTTGATATTTTA
ACCATGCTTGATGAAAAAGAAATTAAAGCAAATGAAGCATTAGATAAATATTTTATTAGCACTTATGTAA
AAGCTAGAGAAGGCTATTATTATGATCTTTTAAATCAAGATTATTTACTTACTCAATTAATGAGTTCTGA
AAAAGTAGCAAATGAATATAGGGCTTTATATGAAGGTGATAATGCAAGAGATCAAATTCTAAAAAACTCC
AATGAAGTAAGTGTTCAAATTTTAAGTATTGTTTTAGGAGAAAGTAACGGAGTGAAAACTGCTACAGTCA
GGGCAATTATTACTACAAAAAATTTAACTTCCAAAGGAACAACTCAAGCAACAAAAGTAATAACATTAAG
TTATGACTATATCTTAGCAAAAGCTAGCGAAGAAAACAGATTTTTAAATCCTTTAGGTTTTAAAGTATTA
ACTTATAGAATTGATGACGAGGTGGCACAATGA
 Primer design