SecReT4
Protein ID: 315123604
T4SS name [ID]VirB [413]
Gene symbol-
Locus tagICDCCJ07001_pTet000026
StrainCampylobacter jejuni subsp. jejuni ICDCCJ07001
Repliconplasmid pTet [GenBank: NC_014801] [Browse all T4SS(s) in this replicon]
Location [Strand]32850..33842 [+]
ProductcmgB11
Component typeVirB11
UniProt IDE6S1C3
KEGG IDcjn:ICDCCJ_pTet000026
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4.4e-61, Aligned region: 13..312
FtsK_SpoIIIE [PF01580], Evalue: 2.1e-05, Aligned region: 159..181
Protein Sequence: 330 a.a.     [Download]
>gi|315123604|ref|YP_004065609.1| cmgB11 [Campylobacter jejuni subsp. jejuni ICDCCJ07001]
MSITLDKYTQKFFGEFLKDDNINEICYNGDNKIWVQNSKGLWECIDTKLDFEQAGHFATASASFKKDKID
VSRPILSCILVGGERMQIVIPPATKSEHISITIRKPSKTRFKMEDHIKSGLFEDLNPDEKNKIKPSDEEL
IKLYEARDYQNFISKAVSYGKNIIIAGETGSGKTTFMKTLIDFISLDDRIITIEDVEEIKFYEHKNFVQL
FYPSEAKSTDFLNSATLLKSCLRMKPDRILLAELRGAETYDFINVLASGHGGSITSCHAGSPEETFTRLA
LMTLQNPQGQCVPFEIIQKTLKDLIDIVVHIHAHHGKRRISGIYFKEMER
 
Nucleotide Sequence: 993 bp     [Download]
>gi|315123578|ref|NC_014801.1|:32850-33842 Campylobacter jejuni subsp. jejuni ICDCCJ07001 plasmid pTet, complete sequence
ATGTCAATAACGCTAGATAAATATACTCAAAAATTTTTTGGAGAATTTTTAAAAGATGATAATATCAATG
AAATCTGTTATAACGGCGATAATAAAATTTGGGTACAAAACTCTAAAGGATTATGGGAATGTATAGATAC
TAAACTTGATTTTGAACAAGCTGGACATTTTGCAACTGCTTCGGCCTCATTCAAAAAAGATAAAATAGAT
GTATCACGCCCTATTCTTAGTTGTATTCTAGTAGGTGGAGAGCGTATGCAAATTGTTATTCCTCCTGCTA
CAAAAAGCGAACACATTTCAATTACTATTAGAAAGCCAAGCAAAACTCGCTTTAAAATGGAAGATCATAT
TAAAAGCGGACTTTTTGAAGATTTAAATCCTGATGAGAAGAATAAAATCAAACCAAGCGATGAAGAATTA
ATCAAGCTATATGAAGCAAGAGATTATCAAAATTTTATATCCAAAGCTGTTAGCTATGGTAAAAATATTA
TTATCGCTGGTGAAACAGGAAGCGGTAAAACTACCTTTATGAAAACTCTTATTGATTTTATAAGCCTTGA
TGATAGGATTATCACAATAGAAGATGTTGAAGAAATCAAATTCTATGAACACAAAAATTTCGTGCAATTA
TTCTATCCTAGCGAAGCAAAAAGTACAGATTTTTTAAATTCTGCAACACTTTTAAAATCTTGTTTAAGAA
TGAAGCCTGATAGAATTTTACTAGCAGAGCTTAGAGGTGCTGAAACTTATGATTTTATTAATGTTTTAGC
TAGTGGTCATGGTGGAAGTATCACAAGTTGCCATGCAGGAAGTCCTGAAGAAACATTTACACGACTTGCT
TTAATGACTCTACAAAATCCACAAGGTCAATGCGTGCCTTTTGAAATTATCCAAAAAACACTTAAAGACT
TAATAGATATTGTCGTGCATATCCATGCCCATCATGGAAAAAGGCGTATTAGCGGCATTTATTTTAAAGA
AATGGAGAGATAA
 Primer design