SecReT4
Protein ID: 315123605
T4SS name [ID]VirB [413]
Gene symbol-
Locus tagICDCCJ07001_pTet000027
StrainCampylobacter jejuni subsp. jejuni ICDCCJ07001
Repliconplasmid pTet [GenBank: NC_014801] [Browse all T4SS(s) in this replicon]
Location [Strand]34281..34814 [+]
ProductcmgD4
Component typeVirD4
UniProt IDE6S1C4
KEGG IDcjn:ICDCCJ_pTet000027
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 3.4e-19, Aligned region: 1..98
Protein Sequence: 177 a.a.     [Download]
>gi|315123605|ref|YP_004065610.1| cmgD4, partial [Campylobacter jejuni subsp. jejuni ICDCCJ07001]
MLEWRESAVVQDIKQECFDYTSKYRKEILGQEVYLFNPFSRQTHRYNPLTYIDMSDKEHCDSQLMDLGNI
LYPQDGDSTSKFFNGLAQNLFIGLCYLWRDLQLTDYGKEFQSAFDINVGEFNFYNILQLSKGFSLKNEGK
TLKGFDDTYNFLSYCEVLDEATIRRLETYFNINCRCY
 
Nucleotide Sequence: 534 bp     [Download]
>gi|315123578|ref|NC_014801.1|:34281-34814 Campylobacter jejuni subsp. jejuni ICDCCJ07001 plasmid pTet, complete sequence
TTGTTAGAGTGGCGAGAAAGTGCTGTTGTTCAAGATATTAAACAAGAATGTTTTGACTACACAAGCAAAT
ATAGAAAAGAGATTTTAGGACAAGAAGTTTATTTATTTAATCCATTTTCAAGACAAACACATCGCTATAA
TCCTTTAACTTATATTGATATGAGTGATAAAGAGCATTGCGATAGTCAATTAATGGATTTAGGTAACATA
CTCTACCCACAAGATGGAGATTCTACCTCAAAATTTTTCAATGGCTTAGCACAAAACTTATTTATTGGGC
TTTGTTATTTATGGCGTGATTTACAATTAACCGATTATGGAAAAGAATTTCAAAGTGCGTTTGATATTAA
TGTAGGAGAATTTAACTTTTACAATATTTTGCAACTCTCAAAAGGTTTCTCACTTAAAAATGAAGGAAAA
ACTTTAAAAGGTTTTGATGATACATACAATTTCTTATCTTATTGTGAAGTTTTAGATGAAGCAACCATAA
GGCGTTTAGAAACTTATTTTAATATTAACTGCAGATGCTACTAA
 Primer design