SecReT4
Protein ID: 315123606
T4SS name [ID]VirB [413]
Gene symbol-
Locus tagICDCCJ07001_pTet000028
StrainCampylobacter jejuni subsp. jejuni ICDCCJ07001
Repliconplasmid pTet [GenBank: NC_014801] [Browse all T4SS(s) in this replicon]
Location [Strand]34825..35517 [+]
Productcmgd4
Component typeVirD4
UniProt IDE6S1C5
KEGG IDcjn:ICDCCJ_pTet000028
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.5e-61, Aligned region: 2..224
TraG-D_C [PF12696], Evalue: 2.5e-26, Aligned region: 79..201
TrwB_AAD_bind [PF10412], Evalue: 1e-14, Aligned region: 21..215
Protein Sequence: 230 a.a.     [Download]
>gi|315123606|ref|YP_004065611.1| cmgd4, partial [Campylobacter jejuni subsp. jejuni ICDCCJ07001]
MSSFNAPLVPFESETLRLSTETSDFDLRDLRKKKMTIYIGITPDQLANAQFILNIFWSQLILLNTKELPQ
SNKDLKYTCLMVMDEFTAPGRIPIYQSAISFMAGYWLRSLMIYQSNSQLETQPPLGYGKEGAKTLLTNHA
CQIFYAPREQEDAEAISRILGNTTFKTKSRSINTGNNGGGSHSISEASRALMLPQELREMPFENELITID
SGKPILCNKAFYYSGFLFYG
 
Nucleotide Sequence: 693 bp     [Download]
>gi|315123578|ref|NC_014801.1|:34825-35517 Campylobacter jejuni subsp. jejuni ICDCCJ07001 plasmid pTet, complete sequence
ATGAGCTCTTTTAATGCTCCGCTTGTGCCATTTGAAAGTGAAACATTAAGATTAAGCACAGAAACAAGCG
ATTTTGATTTGCGAGATTTGCGTAAAAAGAAAATGACAATTTATATAGGAATTACGCCTGATCAATTAGC
AAATGCACAATTTATTTTAAATATTTTTTGGTCGCAACTTATTTTATTAAACACCAAAGAATTGCCACAA
AGCAATAAAGATTTAAAATATACTTGTTTAATGGTTATGGATGAATTTACTGCACCTGGTAGAATTCCTA
TCTATCAATCAGCAATCAGTTTTATGGCTGGTTATTGGTTAAGATCTTTGATGATTTATCAATCAAATTC
ACAACTTGAAACACAACCACCTTTGGGCTATGGAAAAGAAGGAGCTAAAACACTCTTAACAAATCATGCT
TGTCAGATTTTCTATGCACCAAGAGAGCAAGAAGACGCAGAAGCTATCTCTAGGATTTTAGGAAATACTA
CTTTTAAAACAAAATCAAGAAGTATTAATACAGGCAATAATGGAGGTGGATCACATAGTATTAGCGAAGC
AAGTAGGGCTTTAATGTTGCCACAAGAACTTAGAGAAATGCCTTTTGAAAATGAACTAATTACTATTGAT
AGTGGAAAACCTATTTTATGCAATAAAGCATTTTATTATTCAGGATTCTTATTTTATGGATAA
 Primer design