SecReT4
Protein ID: 315500743
T4SS name [ID]Tra_F [514]
Gene symbol-
Locus tagAstex_3783
StrainAsticcacaulis excentricus CB 48 plasmid pASTEX02 (NC_014819)
Repliconplasmid pASTEX02 [GenBank: NC_014819] [Browse all T4SS(s) in this replicon]
Location [Strand]80610..80891 [+]
Producttype IV conjugative transfer system protein TraL
Component typeTraL_F
UniProt IDE8RVX1
KEGG IDaex:Astex_3783
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 1.7e-23, Aligned region: 3..93
Protein Sequence: 93 a.a.     [Download]
>gi|315500743|ref|YP_004089544.1| type IV conjugative transfer system protein TraL [Asticcacaulis excentricus CB 48]
MDTRIPQYLDEPERYFIFTPDELVVVVVPLGILTIVANFLIGLVAGLTAFWLLRRLKKGGSLTRLLWLMF
WILPYEVMGLKKTPPAQHRLMVG
 
Nucleotide Sequence: 282 bp     [Download]
>gi|315500677|ref|NC_014819.1|:80610-80891 Asticcacaulis excentricus CB 48 plasmid pASTEX02, complete sequence
ATGGACACCCGTATTCCTCAGTATCTGGACGAGCCAGAGCGATACTTCATTTTTACACCGGATGAGTTGG
TCGTAGTCGTTGTCCCTCTGGGCATTCTGACGATCGTCGCCAACTTTCTGATCGGTCTCGTCGCGGGTCT
GACAGCCTTTTGGCTGCTCCGCCGCTTGAAGAAGGGCGGCTCGCTGACGCGCCTGCTCTGGCTGATGTTC
TGGATTCTGCCCTACGAGGTGATGGGTCTGAAGAAAACCCCGCCGGCTCAACATCGTCTGATGGTGGGTT
AG
 Primer design