SecReT4
Protein ID: 315500757
T4SS name [ID]Tra_F [514]
Gene symbol-
Locus tagAstex_3797
StrainAsticcacaulis excentricus CB 48 plasmid pASTEX02 (NC_014819)
Repliconplasmid pASTEX02 [GenBank: NC_014819] [Browse all T4SS(s) in this replicon]
Location [Strand]92963..93886 [+]
ProductTraF-like protein
Component typeTraF_F
UniProt IDE8RVY5
KEGG IDaex:Astex_3797
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.7e-52, Aligned region: 47..258
Protein Sequence: 307 a.a.     [Download]
>gi|315500757|ref|YP_004089558.1| TraF-like protein [Asticcacaulis excentricus CB 48]
MNKLAHALAIAIAILTPAMAHAQAPEALASTPAEPEVGTDYCERRLGQWFYCEVPVAPKPKPRAKGTAKR
DDAPAKHPDLVAAEQFKKDMEEARLIAVWNPSAENIQRYYAYQQMVLEKGGTFADTWRRMVWENPDKDYT
LQRPINTAGKAEWLQARNTDRDLFFRAAYDQIGIFYVYRGDCGPCRVASPIVRAFATRYGISVRAISADG
GANPHFPDAQIDKGQLKAWGLTSAVTPAYMIFQKPTTTGKDGIKPVSFRVTDGKTITLRPCRNPKGCLTY
MGAGVLSVDELADRLFVTLATEPGKDF
 
Nucleotide Sequence: 924 bp     [Download]
>gi|315500677|ref|NC_014819.1|:92963-93886 Asticcacaulis excentricus CB 48 plasmid pASTEX02, complete sequence
ATGAATAAACTCGCTCACGCTCTTGCCATTGCCATTGCGATTTTGACGCCCGCCATGGCGCACGCCCAAG
CGCCGGAGGCGCTGGCCTCCACGCCTGCAGAGCCTGAGGTGGGAACGGACTATTGCGAGCGTCGACTGGG
GCAGTGGTTCTACTGCGAGGTACCGGTCGCGCCCAAACCGAAGCCGAGGGCTAAAGGCACGGCAAAGCGT
GACGACGCGCCCGCTAAACATCCCGATCTTGTCGCGGCCGAACAGTTCAAGAAGGACATGGAGGAGGCCC
GTCTCATCGCTGTCTGGAATCCGTCGGCCGAGAACATTCAGCGGTATTACGCCTATCAGCAAATGGTCCT
GGAGAAGGGCGGCACGTTTGCCGATACGTGGAGGCGTATGGTCTGGGAGAATCCTGACAAGGATTACACC
CTGCAGCGGCCGATCAACACGGCCGGAAAGGCCGAGTGGCTTCAGGCGCGCAATACCGATCGCGACCTGT
TCTTCAGGGCCGCTTACGACCAGATCGGCATCTTCTATGTCTATCGTGGCGACTGCGGGCCTTGCCGGGT
TGCGTCCCCGATCGTGCGAGCGTTCGCCACCCGGTATGGGATTTCGGTCAGGGCGATTTCAGCGGACGGT
GGAGCGAACCCGCACTTTCCGGATGCGCAGATCGACAAGGGGCAGCTTAAGGCCTGGGGTCTGACCTCGG
CGGTGACGCCGGCCTACATGATTTTTCAGAAACCGACCACGACCGGCAAGGACGGCATCAAACCGGTCTC
GTTCCGGGTGACCGATGGCAAGACGATCACGCTGCGGCCGTGCCGTAACCCGAAGGGGTGCCTGACCTAT
ATGGGCGCCGGTGTGTTGTCGGTCGATGAACTGGCCGACCGGCTTTTTGTGACCCTGGCCACCGAGCCGG
GCAAGGATTTTTAG
 Primer design