SecReT4
Protein ID: 317052831
T4SS name [ID]Tra_F [127]
Gene symbol-
Locus tagPat9b_4061
StrainPantoea sp. At-9b plasmid pPAT9B05 (NC_014842)
Repliconplasmid pPAT9B05 [GenBank: NC_014842] [Browse all T4SS(s) in this replicon]
Location [Strand]56445..56978 [-]
ProductLytic transglycosylase catalytic
Component typeOrf169_F
UniProt IDE6WNQ6
KEGG IDpao:Pat9b_4061
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 177 a.a.     [Download]
>gi|317052831|ref|YP_004119597.1| Lytic transglycosylase catalytic [Pantoea sp. At-9b]
MKWFAVLGLAAVFSVQAEPEMCFTKAGKDFGIDPRLLMAHSIQESRMRNNALNTKSSGGTHDVCNMQINS
SHFSQLKKFDITRERLLKDPCICIYTGAWIEARNFRQYGRNWDSVGMYNTGPSPKLIKQRREYAAIIKSI
YRVLIARDEVYVAMTQKNKKTPAPETFISADVDTPIK
 
Nucleotide Sequence: 534 bp     [Download]
>gi|317052773|ref|NC_014842.1|:c56978-56445 Pantoea sp. At-9b plasmid pPAT9B05, complete sequence
ATGAAATGGTTTGCTGTTCTCGGGCTCGCCGCTGTATTCAGCGTGCAGGCCGAACCGGAAATGTGCTTCA
CGAAAGCCGGAAAGGATTTCGGTATTGATCCGCGCCTGCTGATGGCACACTCCATTCAGGAATCACGCAT
GCGTAATAATGCGCTGAATACCAAAAGTAGCGGGGGAACGCATGACGTCTGCAACATGCAGATCAACAGT
TCTCATTTCAGTCAGCTGAAAAAGTTTGATATTACGCGGGAAAGGCTGCTGAAAGATCCGTGCATCTGCA
TTTATACCGGCGCATGGATCGAGGCGCGCAACTTCAGACAGTACGGCAGAAACTGGGACAGCGTCGGAAT
GTATAATACCGGACCCAGCCCGAAGCTGATAAAACAGCGTCGGGAGTATGCAGCAATAATTAAAAGTATC
TATCGCGTGCTGATCGCCCGCGATGAGGTTTATGTTGCCATGACACAGAAGAATAAAAAAACGCCTGCGC
CGGAAACCTTTATCAGCGCAGACGTTGACACCCCCATAAAATAA
 Primer design