SecReT4
Protein ID: 317052834
T4SS name [ID]Tra_F [127]
Gene symbol-
Locus tagPat9b_4064
StrainPantoea sp. At-9b plasmid pPAT9B05 (NC_014842)
Repliconplasmid pPAT9B05 [GenBank: NC_014842] [Browse all T4SS(s) in this replicon]
Location [Strand]59561..59953 [+]
ProductTraA family protein
Component typeTraA_F
UniProt IDE6WNQ9
KEGG IDpao:Pat9b_4064
PDB IDNA
Domain hit(s) vs Pfam TraA [PF05513], Evalue: 1.3e-11, Aligned region: 44..125
Protein Sequence: 130 a.a.     [Download]
>gi|317052834|ref|YP_004119600.1| TraA family protein [Pantoea sp. At-9b]
MKVVTGKPALAEGAAEACPAFRTAAPSGFIGTLYRSFSLLWRHRVNVLLIALAVLFFALPHLVRAEDLLS
SQKQDAKDTFGHGSTIEWGLYIAEVIISIGAYIKTRNPMLFVGGLGFLIVVTRVLFSLAG
 
Nucleotide Sequence: 393 bp     [Download]
>gi|317052773|ref|NC_014842.1|:59561-59953 Pantoea sp. At-9b plasmid pPAT9B05, complete sequence
ATGAAAGTTGTCACAGGCAAACCCGCGCTGGCGGAGGGGGCTGCGGAAGCCTGCCCGGCGTTCCGGACCG
CAGCACCATCCGGTTTTATCGGCACGCTTTACCGCAGCTTTAGTCTTCTCTGGCGTCACCGCGTTAACGT
GCTGCTGATTGCTCTGGCGGTGCTGTTCTTCGCGCTCCCGCATCTGGTGCGCGCCGAAGACCTGCTCTCC
AGCCAGAAACAGGACGCGAAGGATACGTTCGGCCACGGCAGCACCATCGAGTGGGGGCTGTACATTGCCG
AGGTCATCATCTCCATCGGCGCCTACATCAAAACCCGCAACCCGATGCTGTTCGTGGGCGGCCTCGGCTT
CCTCATCGTCGTCACCCGCGTTCTCTTCAGCCTCGCCGGTTAA
 Primer design