SecReT4
Protein ID: 317052835
T4SS name [ID]Tra_F [127]
Gene symbol-
Locus tagPat9b_4065
StrainPantoea sp. At-9b plasmid pPAT9B05 (NC_014842)
Repliconplasmid pPAT9B05 [GenBank: NC_014842] [Browse all T4SS(s) in this replicon]
Location [Strand]59962..60264 [+]
Producttype IV conjugative transfer system protein TraL
Component typeTraL_F
UniProt IDE6WNR0
KEGG IDpao:Pat9b_4065
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 7.5e-29, Aligned region: 7..99
Protein Sequence: 100 a.a.     [Download]
>gi|317052835|ref|YP_004119601.1| type IV conjugative transfer system protein TraL [Pantoea sp. At-9b]
MDRESLQYQFPETLNQQKRLLGLPPEEAGVIVACAGIGLLCDMFIVMLVVAGALWLLIRHLKKGQGTWWL
LNLLYWYLPTALLRLQFRRVPDSGNRHWMQ
 
Nucleotide Sequence: 303 bp     [Download]
>gi|317052773|ref|NC_014842.1|:59962-60264 Pantoea sp. At-9b plasmid pPAT9B05, complete sequence
ATGGACAGGGAATCGCTTCAGTACCAGTTCCCGGAAACCCTCAATCAGCAGAAACGCCTGCTCGGACTCC
CGCCAGAGGAGGCCGGCGTCATCGTTGCGTGCGCCGGTATCGGCCTGCTCTGCGACATGTTCATCGTGAT
GCTGGTTGTGGCCGGCGCGTTGTGGCTGTTAATCCGCCATCTGAAGAAGGGGCAGGGCACCTGGTGGCTC
CTGAACCTCCTTTACTGGTATCTGCCGACCGCGCTGCTCCGGCTGCAGTTCAGGCGGGTGCCCGACTCGG
GCAACCGGCACTGGATGCAGTAA
 Primer design