SecReT4
Protein ID: 317052836
T4SS name [ID]Tra_F [127]
Gene symbol-
Locus tagPat9b_4066
StrainPantoea sp. At-9b plasmid pPAT9B05 (NC_014842)
Repliconplasmid pPAT9B05 [GenBank: NC_014842] [Browse all T4SS(s) in this replicon]
Location [Strand]60316..60915 [+]
ProductTraE family protein
Component typeTraE_F
UniProt IDE6WNR1
KEGG IDpao:Pat9b_4066
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 6.9e-35, Aligned region: 1..188
Protein Sequence: 199 a.a.     [Download]
>gi|317052836|ref|YP_004119602.1| TraE family protein [Pantoea sp. At-9b]
MRYKVREGRNRVTVLALAGLGSLLALSLAANGITGALAWHFARTQKTITVPMLFDRPFVSTAASGDDALN
GLLVRSFINLRLSVTPETVDSQHAALLRFVPPEDRDAMKKQLAAEAEYIRKNGVSSVFRLDDETTDTTTG
DIIARGTLSAGTTNGNLKLSLPDTKKAWRLSVHYVDGLIRLTAFTEVPWTQPDRRPQQE
 
Nucleotide Sequence: 600 bp     [Download]
>gi|317052773|ref|NC_014842.1|:60316-60915 Pantoea sp. At-9b plasmid pPAT9B05, complete sequence
ATGAGGTACAAGGTCCGGGAGGGGCGCAATCGTGTAACAGTGCTGGCGCTGGCGGGGCTGGGTTCGCTTC
TGGCCCTGAGCCTTGCCGCGAACGGCATCACCGGCGCCCTCGCGTGGCACTTTGCCCGCACCCAGAAAAC
CATCACCGTTCCCATGCTGTTTGACCGGCCGTTTGTCTCCACCGCCGCCTCCGGAGACGACGCCCTGAAC
GGACTGCTGGTCCGCTCGTTTATCAATCTCCGCCTGTCCGTCACGCCCGAGACCGTGGACAGCCAGCACG
CCGCCCTGCTGCGCTTTGTCCCGCCGGAAGACCGTGACGCCATGAAAAAACAGCTTGCCGCCGAAGCTGA
GTACATCAGAAAGAACGGCGTCTCCTCCGTGTTCCGCCTTGACGATGAAACCACCGACACCACCACCGGT
GACATCATCGCCCGGGGAACGCTGAGCGCCGGCACCACCAACGGCAACCTGAAACTTTCGCTGCCGGACA
CGAAAAAAGCCTGGCGACTCAGCGTGCACTACGTGGACGGCCTTATCCGCCTGACGGCCTTCACGGAAGT
ACCCTGGACGCAACCTGACCGCCGCCCGCAACAGGAATGA
 Primer design