SecReT4
Protein ID: 317052837
T4SS name [ID]Tra_F [127]
Gene symbol-
Locus tagPat9b_4067
StrainPantoea sp. At-9b plasmid pPAT9B05 (NC_014842)
Repliconplasmid pPAT9B05 [GenBank: NC_014842] [Browse all T4SS(s) in this replicon]
Location [Strand]60919..61656 [+]
Producttype-F conjugative transfer system secretin TraK
Component typeTraK_F
UniProt IDE6WNR2
KEGG IDpao:Pat9b_4067
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 4e-47, Aligned region: 11..235
Protein Sequence: 245 a.a.     [Download]
>gi|317052837|ref|YP_004119603.1| type-F conjugative transfer system secretin TraK [Pantoea sp. At-9b]
MKKTVSVLTALAALTLVPAVASAVVPGPAGTVFENNAHLKAQMSNTSPNKIVIDGELITAVTGPEGAYTK
DSTADGALLITPLTGQDFTLFIETAGGVSVSLDVSPKPGSGRTLELIPADVPLKPNPDAKAWEESQPFQK
TLVSVARTVANGGVPDGYTDMKASRAPAYNPPAGVLLTPERQLAGSHLRVMRYRMKNTGYVTRTLSEKQF
WQQGVRAVMLSTRTLYANGEGYVWVIFSTDKEGGA
 
Nucleotide Sequence: 738 bp     [Download]
>gi|317052773|ref|NC_014842.1|:60919-61656 Pantoea sp. At-9b plasmid pPAT9B05, complete sequence
ATGAAGAAAACCGTTTCCGTGCTCACCGCTCTGGCAGCGCTCACGCTGGTGCCTGCTGTGGCCTCAGCTG
TGGTGCCCGGCCCGGCCGGCACCGTATTTGAGAATAACGCGCACCTCAAAGCGCAGATGAGCAACACCAG
CCCGAACAAAATCGTCATTGACGGGGAGCTTATCACCGCCGTCACCGGTCCGGAGGGCGCGTACACAAAA
GACAGCACCGCCGACGGCGCACTGCTCATCACCCCGCTGACCGGGCAGGATTTCACCCTCTTTATCGAAA
CGGCCGGCGGGGTGAGCGTCTCGCTCGACGTGTCCCCGAAACCCGGCAGCGGCCGCACGCTGGAGCTTAT
TCCGGCGGACGTGCCGCTGAAGCCGAACCCGGATGCGAAGGCGTGGGAGGAGAGCCAGCCGTTCCAGAAG
ACGCTGGTCAGCGTGGCGCGCACCGTGGCAAACGGCGGCGTGCCTGACGGCTATACCGACATGAAGGCCA
GCCGGGCTCCGGCGTACAACCCGCCTGCCGGCGTCCTGCTCACGCCGGAGCGACAGCTGGCAGGCTCGCA
CCTGCGCGTGATGCGTTACCGGATGAAAAACACCGGTTACGTCACCCGCACCCTCAGTGAAAAGCAGTTC
TGGCAGCAGGGCGTGCGCGCCGTGATGCTCTCCACCCGCACCCTGTATGCGAACGGCGAAGGGTACGTGT
GGGTGATTTTCTCCACGGATAAGGAGGGCGGGGCATGA
 Primer design