SecReT4
Protein ID: 317052838
T4SS name [ID]Tra_F [127]
Gene symbol-
Locus tagPat9b_4068
StrainPantoea sp. At-9b plasmid pPAT9B05 (NC_014842)
Repliconplasmid pPAT9B05 [GenBank: NC_014842] [Browse all T4SS(s) in this replicon]
Location [Strand]61653..63020 [+]
ProductTraB pilus assembly family protein
Component typeTraB_F
UniProt IDE6WNR3
KEGG IDpao:Pat9b_4068
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.6e-41, Aligned region: 200..397
Protein Sequence: 455 a.a.     [Download]
>gi|317052838|ref|YP_004119604.1| TraB pilus assembly family protein [Pantoea sp. At-9b]
MSSINTLTRRRQWMIAGAAAAVMLATGGGIWAYSRHQAELNHPAQKSAPDMTGSLVSTSFTSGVATSALQ
QQQNKTAGLEKDLSTLTGTLKTQNEDLKKQLSTMADAIAQLQKQQSQEGNKPPAGPGQTTTPPAGPAANA
PVATGPAGPAQWRVSDPSGGPSAGQGSRFYPGTGTVRAGGLQRDTFTYASLAAKKTNLPWIPSGSFSEAV
MIEGADANASVTGQQNTSPVVITLIGDVSLPNGKTYSLDQCRVTGEIYGDISSERGEVRTKNISCILKNG
KHIDMPFDGHVAYQGKQGIRGKPVMRNGAIIANAGAAGLLSGFGEGIKSAATPTVGLGASASVGAGDILK
QGLGGGASKAADTLSQYWIKRAEQYHPVIDIGAGNAVTVVFQQGFRLETIEDAEAEKEKKAAPQPSAQQT
AAVTPANSGGGNAPVLNPDEVLRQASQLRLGDTIN
 
Nucleotide Sequence: 1368 bp     [Download]
>gi|317052773|ref|NC_014842.1|:61653-63020 Pantoea sp. At-9b plasmid pPAT9B05, complete sequence
ATGAGCAGCATCAATACCCTGACCCGCCGCCGGCAGTGGATGATTGCCGGCGCGGCCGCGGCGGTGATGC
TCGCCACCGGCGGCGGTATCTGGGCGTATTCACGCCATCAGGCTGAACTGAACCATCCGGCACAGAAGTC
CGCGCCGGATATGACCGGCAGCCTGGTCAGCACGTCCTTCACCAGCGGCGTGGCCACCTCGGCGCTGCAG
CAGCAGCAGAATAAAACCGCCGGGCTGGAGAAAGACCTCTCAACACTTACCGGGACGCTGAAAACGCAGA
ATGAGGACCTGAAGAAGCAGCTCAGTACGATGGCAGATGCCATCGCTCAGTTACAGAAGCAGCAGTCTCA
GGAAGGTAACAAACCGCCGGCCGGACCAGGACAGACCACCACCCCGCCGGCCGGTCCCGCTGCGAATGCC
CCGGTGGCCACCGGCCCGGCGGGACCGGCGCAGTGGCGTGTGAGCGATCCGTCAGGGGGGCCTTCTGCCG
GTCAGGGAAGCCGGTTTTACCCCGGCACCGGCACGGTACGCGCCGGTGGCCTGCAGCGTGACACCTTCAC
GTATGCTTCGCTCGCGGCGAAAAAAACGAACCTGCCGTGGATACCGTCGGGTTCGTTCTCCGAGGCGGTC
ATGATTGAGGGGGCAGACGCCAACGCCAGCGTGACCGGTCAGCAGAATACCTCGCCCGTGGTCATCACCC
TTATCGGCGATGTCTCCCTGCCCAACGGCAAAACGTACAGCCTCGACCAGTGCCGCGTCACCGGGGAAAT
CTACGGTGATATTTCCAGCGAGCGCGGCGAAGTCCGCACGAAAAACATCAGCTGCATCCTGAAAAACGGT
AAGCACATCGATATGCCGTTTGACGGACATGTGGCTTACCAGGGCAAGCAGGGTATCCGCGGCAAGCCGG
TCATGCGCAACGGGGCCATCATTGCCAATGCCGGTGCGGCCGGCCTGCTGTCCGGTTTCGGTGAGGGCAT
CAAATCGGCCGCCACGCCGACCGTGGGTCTGGGGGCCTCGGCGTCTGTGGGCGCGGGCGATATCCTCAAG
CAGGGACTCGGCGGCGGGGCCAGCAAGGCCGCTGACACGCTGAGTCAGTACTGGATCAAGCGTGCCGAGC
AGTACCACCCGGTGATTGATATCGGCGCCGGTAACGCCGTCACCGTGGTGTTCCAGCAGGGCTTCCGGCT
GGAGACCATTGAGGATGCGGAAGCAGAGAAAGAGAAGAAAGCCGCGCCACAGCCTAGCGCGCAGCAGACT
GCCGCGGTCACGCCGGCAAACAGCGGTGGCGGCAATGCCCCGGTACTGAACCCCGACGAAGTGCTGCGTC
AGGCCAGCCAGCTGCGCCTGGGTGACACCATCAACTGA
 Primer design