SecReT4
Protein ID: 317052843
T4SS name [ID]Tra_F [127]
Gene symbol-
Locus tagPat9b_4073
StrainPantoea sp. At-9b plasmid pPAT9B05 (NC_014842)
Repliconplasmid pPAT9B05 [GenBank: NC_014842] [Browse all T4SS(s) in this replicon]
Location [Strand]64900..65448 [+]
Producttype IV conjugative transfer system protein TraV
Component typeTraV_F
UniProt IDE6WNR8
KEGG IDpao:Pat9b_4073
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 3.7e-23, Aligned region: 21..171
Protein Sequence: 182 a.a.     [Download]
>gi|317052843|ref|YP_004119609.1| type IV conjugative transfer system protein TraV [Pantoea sp. At-9b]
MQKLFACALLCAALTGCAGMNSDFDCNKTATDQCLSMSDASHLASKHQSLDDLSAAKDSGPKPAAEALAT
PGNLKPAVNPNRTVSVATIAPRAVAGQPVSPALLRASTVPVHTAAVTAGNITPADYSGPGQVDARRIPDA
TQRLWIAPWVDEQDSFHQPAVVEFVKQKSRWDEDFRVISEGE
 
Nucleotide Sequence: 549 bp     [Download]
>gi|317052773|ref|NC_014842.1|:64900-65448 Pantoea sp. At-9b plasmid pPAT9B05, complete sequence
ATGCAAAAACTCTTTGCGTGCGCACTGCTGTGCGCTGCGCTCACCGGCTGCGCCGGTATGAACTCCGACT
TTGACTGCAACAAAACCGCCACCGACCAGTGCCTCTCGATGTCGGACGCCAGCCACCTGGCGTCAAAACA
CCAGAGCCTCGACGACCTGAGCGCCGCGAAGGACAGCGGCCCAAAGCCTGCGGCTGAGGCGCTGGCGACG
CCCGGCAACCTGAAGCCTGCCGTTAATCCGAACCGCACCGTCAGTGTGGCCACGATCGCACCCCGCGCCG
TGGCGGGACAGCCCGTCAGTCCCGCATTGCTCCGTGCCTCCACGGTACCGGTGCACACCGCTGCAGTGAC
GGCCGGCAACATCACGCCGGCCGATTACAGCGGACCCGGCCAGGTGGATGCCCGGCGTATTCCGGACGCC
ACGCAGCGCCTGTGGATAGCGCCCTGGGTGGATGAGCAGGACAGCTTCCATCAGCCTGCTGTCGTGGAGT
TCGTGAAGCAGAAGTCCCGCTGGGACGAAGACTTTCGCGTGATAAGCGAGGGAGAGTAA
 Primer design