SecReT4
Protein ID: 317052845
T4SS name [ID]Tra_F [127]
Gene symbol-
Locus tagPat9b_4075
StrainPantoea sp. At-9b plasmid pPAT9B05 (NC_014842)
Repliconplasmid pPAT9B05 [GenBank: NC_014842] [Browse all T4SS(s) in this replicon]
Location [Strand]65725..68370 [+]
Producttype-IV secretion system protein TraC
Component typeTraC_F
UniProt IDE6WNS0
KEGG IDpao:Pat9b_4075
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 2.8e-52, Aligned region: 35..282
AAA_10 [PF12846], Evalue: 1.1e-41, Aligned region: 485..777
Protein Sequence: 881 a.a.     [Download]
>gi|317052845|ref|YP_004119611.1| type-IV secretion system protein TraC [Pantoea sp. At-9b]
MLSNVIDHLAGILSSSRDEGGAKAASKMLRENFSYPSLTSLLPYREYDEKSDLFINGRSVGFIMEVAPLA
GANQQVVQALDDLLRKKLPRKTPVTVLMVASKCVGDMLENGLSRDMWKGSMAPRLNAITRAYWERSALKG
LVNNREYPLYLRNYRVFLVYAHPGTGGIRVMDEVAQIRETLRVSMMAAHMDTRRVAAAEFLTVIREQLNY
RPGQVNAGTENWNPEQELHRQCVDHSTELEVHPGYLRLTTARQPGDRRMGDEADTAVASTRIVNMQLTKV
PKKFALWQAADNLQNMRFPDLGIPCPFLLSWTICVEEQVSSQNEAFRKEQDMGKKANSSYGKLFPNTQRT
YEEWRDLRMGLNSNEIAMCSFSMNLTLFCPDDDSEQQACELAAINVFRKNDLEMSAPRYQQLRNWLTTFP
FLMQEGLWDDMKHMNATLRCKSFNAVNLMPVVAERQMAPSGSPLPTYRNALAFFDMFSESNGATNFNIAV
TGTTGAGKSFFIQEILRQVLNSGGFGWVIDMGGSYRNFCKQAGGAYLDGATLRFNPFANVRDIKESAEGI
QGLLTVLASPNDALDKVSETILLKGVVAAWEAKLNRARIDDVVLYMKSQDVRSEYGNQPTIMNRINELVL
LLDRWCTWGANGDYFNSDKPTLDGDTRFAVLELLSLENQPHLLSAILYSLILAIQEKMYHSPRSLKKVAI
IDEAWRLFSGSNPHAARFIETGYRTVRRHRGAFITITQGIKDFTGTKDQAAPPAAAAAWDCSGTKVTLLQ
DAKAFKTYLNANPDQFSEMETQVIRGFQPARDTGFSSVMISSGEYSSFHRVFVDPVTRAMFSTRGEDYQY
MSDAQEAGATSEEAAYLLACEPHMYQAEMQELERWAGLPAA
 
Nucleotide Sequence: 2646 bp     [Download]
>gi|317052773|ref|NC_014842.1|:65725-68370 Pantoea sp. At-9b plasmid pPAT9B05, complete sequence
ATGCTCAGTAACGTTATCGATCACCTTGCCGGTATCCTGAGCAGCAGCCGCGACGAGGGCGGGGCAAAAG
CCGCCTCAAAAATGCTGCGGGAAAACTTCAGCTACCCCTCGCTGACCAGCCTGCTGCCTTACCGTGAGTA
CGATGAGAAATCCGACCTGTTTATCAACGGCCGGTCCGTCGGTTTCATCATGGAGGTGGCACCGCTCGCC
GGCGCTAACCAGCAGGTGGTGCAGGCACTGGACGACCTGCTGCGCAAAAAACTCCCCCGTAAAACACCGG
TCACCGTGCTGATGGTCGCCAGCAAGTGCGTGGGGGACATGCTGGAGAACGGGCTGAGCCGCGACATGTG
GAAAGGCAGCATGGCACCGCGCCTCAACGCCATCACCAGAGCCTACTGGGAACGCTCAGCGCTGAAAGGG
CTGGTGAATAACCGCGAATATCCGCTCTATCTGCGTAACTACCGCGTGTTTCTGGTGTATGCCCACCCGG
GTACCGGCGGCATCCGGGTCATGGATGAGGTGGCGCAGATCCGCGAAACCCTGCGCGTGTCGATGATGGC
CGCGCACATGGACACCCGACGGGTGGCGGCGGCCGAATTCCTGACGGTCATTCGTGAGCAGCTCAACTAC
CGTCCTGGGCAGGTGAATGCCGGTACGGAAAACTGGAATCCGGAGCAGGAGCTGCACCGCCAGTGCGTGG
ACCACAGTACCGAGCTGGAGGTGCACCCGGGTTACCTGCGCCTCACCACGGCGCGCCAGCCCGGTGACAG
GCGCATGGGGGATGAGGCGGATACCGCCGTTGCCAGCACGCGCATCGTGAATATGCAGCTGACAAAGGTA
CCGAAGAAGTTTGCCCTCTGGCAGGCGGCGGACAACCTGCAGAACATGCGTTTTCCGGACCTTGGCATCC
CCTGTCCGTTTCTGCTGAGCTGGACCATCTGCGTCGAGGAGCAGGTCAGCAGCCAGAACGAAGCGTTCCG
TAAGGAACAGGACATGGGTAAAAAGGCCAACTCCTCCTACGGAAAACTCTTCCCCAACACGCAGCGCACC
TATGAGGAGTGGCGTGACCTGCGCATGGGGCTGAACAGCAACGAAATCGCCATGTGCAGTTTCAGCATGA
ACCTGACGCTGTTCTGCCCGGATGACGACAGTGAACAGCAGGCCTGTGAGCTCGCCGCCATCAACGTGTT
CCGCAAGAACGATCTGGAGATGTCTGCACCGCGCTACCAGCAGCTGCGCAACTGGCTCACCACCTTCCCG
TTCCTGATGCAGGAGGGGCTGTGGGACGACATGAAGCACATGAATGCCACCCTGCGCTGCAAGAGCTTCA
ACGCGGTCAACCTGATGCCGGTGGTCGCCGAGCGGCAGATGGCCCCTTCGGGAAGCCCGCTGCCGACCTA
CCGTAACGCGCTGGCGTTTTTTGACATGTTCAGCGAGAGCAACGGTGCCACCAACTTCAATATCGCGGTC
ACCGGCACCACCGGTGCCGGTAAAAGCTTCTTTATCCAGGAGATCCTGCGTCAGGTACTTAATTCCGGCG
GGTTTGGCTGGGTTATCGATATGGGGGGCAGCTACCGCAACTTCTGTAAACAGGCGGGGGGCGCCTATCT
CGATGGGGCCACGCTGCGCTTTAACCCGTTTGCCAACGTGCGCGATATCAAGGAATCGGCCGAGGGCATA
CAGGGGCTGCTGACCGTGCTGGCAAGTCCGAACGATGCGCTGGACAAGGTCAGTGAGACCATCCTGCTCA
AGGGCGTCGTGGCTGCCTGGGAGGCGAAGCTGAACCGGGCGCGTATCGATGACGTGGTGCTGTACATGAA
ATCGCAGGATGTCCGGTCAGAGTACGGCAACCAGCCGACCATCATGAACCGCATCAACGAGCTGGTGCTG
CTGCTGGACCGCTGGTGTACCTGGGGAGCCAACGGTGATTACTTCAACTCGGACAAACCGACGCTTGACG
GTGACACCCGTTTTGCGGTGCTGGAGCTGCTGAGTCTGGAAAACCAGCCGCATCTGCTGTCCGCCATCCT
GTACTCACTCATTCTGGCGATTCAGGAAAAGATGTACCACTCGCCGCGCAGTCTGAAGAAGGTGGCCATT
ATCGACGAAGCCTGGCGTCTGTTCAGCGGCTCCAACCCGCACGCGGCGCGCTTTATCGAAACCGGCTATC
GCACGGTGCGCCGCCATCGCGGGGCGTTCATCACCATCACGCAGGGTATCAAAGACTTCACCGGTACCAA
AGACCAGGCGGCACCGCCGGCAGCGGCAGCAGCGTGGGACTGTTCCGGTACCAAAGTCACGCTACTGCAG
GATGCGAAAGCGTTCAAAACCTACCTCAATGCCAATCCGGATCAGTTCAGCGAAATGGAGACGCAGGTTA
TCCGCGGTTTCCAGCCCGCCCGCGATACGGGGTTCAGTTCGGTGATGATTTCCAGCGGGGAATACAGTTC
CTTCCACCGGGTGTTTGTGGACCCGGTGACGCGTGCGATGTTCAGCACCCGCGGGGAAGACTATCAGTAT
ATGAGCGATGCGCAGGAGGCGGGGGCAACCAGCGAGGAGGCCGCGTACCTGCTGGCCTGTGAGCCGCACA
TGTATCAGGCCGAAATGCAGGAGCTTGAGCGCTGGGCCGGTCTGCCGGCGGCGTAA
 Primer design