SecReT4
Protein ID: 317052847
T4SS name [ID]Tra_F [127]
Gene symbol-
Locus tagPat9b_4077
StrainPantoea sp. At-9b plasmid pPAT9B05 (NC_014842)
Repliconplasmid pPAT9B05 [GenBank: NC_014842] [Browse all T4SS(s) in this replicon]
Location [Strand]68838..69458 [+]
Producttype-F conjugative transfer system protein TraW
Component typeTraW_F
UniProt IDE6WNS2
KEGG IDpao:Pat9b_4077
PDB IDNA
Domain hit(s) vs Pfam TraW_N [PF12477], Evalue: 1.1e-05, Aligned region: 3..33
Protein Sequence: 206 a.a.     [Download]
>gi|317052847|ref|YP_004119613.1| type-F conjugative transfer system protein TraW [Pantoea sp. At-9b]
MRSRLAVLLLVLAFPLFTSAKDLGTLGHLFPIAEPDLLTFIGQRLQGMKESGELDRIQREAEARVKAHAV
RPEPVAGLTPAVKDRTFRYDPTFTVQETVRDMQGNVIARAGDRVNPLDKVPYSETLYFIDGDNPVQMTWV
RQQLTGQQNFKVILVKGNIRDTSLALDEPVYFDQYGTLTTKFGFEHTPVRITRDDRWLKVEEVALK
 
Nucleotide Sequence: 621 bp     [Download]
>gi|317052773|ref|NC_014842.1|:68838-69458 Pantoea sp. At-9b plasmid pPAT9B05, complete sequence
ATGAGGTCCCGGCTGGCAGTGCTGCTGCTTGTCCTGGCGTTCCCGCTGTTCACCAGCGCAAAAGACCTCG
GCACCCTCGGGCATCTGTTCCCGATTGCAGAACCTGACCTGCTGACCTTTATCGGTCAGCGGCTGCAGGG
GATGAAGGAGAGCGGGGAGCTGGACAGGATACAGCGCGAGGCCGAAGCGCGGGTAAAGGCCCATGCGGTG
AGACCTGAACCCGTAGCGGGGCTTACGCCGGCGGTGAAAGACCGGACGTTCCGCTATGACCCGACCTTTA
CCGTGCAGGAAACGGTCCGGGACATGCAGGGTAACGTGATTGCCCGCGCCGGTGACCGGGTGAACCCGCT
GGATAAGGTGCCGTACAGCGAGACGCTGTACTTCATCGATGGCGATAATCCGGTGCAGATGACGTGGGTC
CGGCAGCAACTGACCGGTCAGCAGAACTTTAAGGTCATTCTGGTGAAGGGCAATATCCGGGACACCAGTC
TGGCGCTGGATGAACCGGTGTACTTCGACCAGTACGGCACGTTAACAACAAAATTCGGCTTTGAGCACAC
GCCGGTACGCATCACGCGCGATGACCGCTGGCTTAAGGTGGAGGAGGTGGCACTGAAATGA
 Primer design