SecReT4
Protein ID: 317052851
T4SS name [ID]Tra_F [127]
Gene symbol-
Locus tagPat9b_4081
StrainPantoea sp. At-9b plasmid pPAT9B05 (NC_014842)
Repliconplasmid pPAT9B05 [GenBank: NC_014842] [Browse all T4SS(s) in this replicon]
Location [Strand]70645..71637 [+]
ProductTraU family protein
Component typeTraU_F
UniProt IDE6WNS6
KEGG IDpao:Pat9b_4081
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 4.8e-78, Aligned region: 31..329
Protein Sequence: 330 a.a.     [Download]
>gi|317052851|ref|YP_004119617.1| TraU family protein [Pantoea sp. At-9b]
MKRFFLVACLLLSAILAKPVMAAASNAGDGRWVNPISDVCWKCLFPMTLGSIQLASGSHPDTPNPGSPIQ
LCPVGILYRLGLAIGFWEPMAMTDVTREPGVMVNMGGFKIDLGRTGTGTGGQSDRPVAGAFYHVHWYKYP
LIWWLNIITSVGCMQTGDMDIAYLSEVDPLWNDSTLSMIINPEVALFSNLVAQGACAADALASATGMPLD
PLFWCAGAQGSMYPFTGYTSNEFSPLEASLLVSERMAFKLHREGLVMETVGADTAVCYEYPSPIMPKSRW
RYQMVNMYPEPSDCHPFGTTTQLWGSTHNSPTSKKNFGYLLWRKRNCVFL
 
Nucleotide Sequence: 993 bp     [Download]
>gi|317052773|ref|NC_014842.1|:70645-71637 Pantoea sp. At-9b plasmid pPAT9B05, complete sequence
ATGAAACGGTTCTTTCTTGTTGCCTGCCTGCTGCTCTCTGCCATTCTGGCAAAGCCGGTCATGGCGGCGG
CCAGTAATGCCGGCGACGGTCGCTGGGTGAATCCCATCAGCGACGTCTGCTGGAAGTGCCTGTTCCCGAT
GACGCTCGGCAGCATTCAGCTGGCTTCCGGTTCGCATCCGGACACGCCGAACCCGGGCTCCCCCATTCAG
CTCTGCCCGGTGGGCATACTTTACCGGCTGGGGCTGGCCATCGGATTCTGGGAGCCGATGGCGATGACTG
ACGTAACCCGTGAACCCGGGGTGATGGTCAATATGGGCGGCTTTAAAATCGATCTCGGGCGGACCGGCAC
CGGCACCGGCGGGCAGAGTGATCGCCCCGTCGCTGGCGCGTTCTATCACGTTCACTGGTACAAGTACCCG
CTTATCTGGTGGCTGAACATCATCACCAGCGTCGGCTGCATGCAGACCGGGGACATGGACATTGCTTACC
TCTCTGAGGTTGACCCGCTCTGGAACGACAGCACGCTGTCCATGATCATTAACCCGGAGGTGGCGCTGTT
CAGTAACCTGGTGGCGCAGGGGGCCTGTGCGGCCGATGCGCTGGCGTCCGCCACGGGGATGCCGCTGGAC
CCGCTGTTCTGGTGTGCCGGTGCGCAGGGTTCGATGTATCCCTTTACGGGCTATACCAGCAACGAGTTTT
CCCCGCTGGAGGCCTCGCTGCTGGTCAGCGAACGCATGGCCTTCAAGCTGCACCGGGAAGGACTGGTGAT
GGAAACGGTGGGGGCGGATACCGCCGTCTGTTATGAATACCCCTCCCCGATCATGCCGAAATCACGCTGG
CGCTATCAGATGGTGAACATGTACCCGGAACCCTCGGACTGTCACCCGTTCGGCACCACCACCCAGCTGT
GGGGCAGTACACACAATTCCCCGACCTCGAAAAAGAACTTCGGTTATCTCCTGTGGCGCAAACGTAACTG
CGTTTTCCTGTAA
 Primer design