SecReT4
Protein ID: 317052852
T4SS name [ID]Tra_F [127]
Gene symbol-
Locus tagPat9b_4082
StrainPantoea sp. At-9b plasmid pPAT9B05 (NC_014842)
Repliconplasmid pPAT9B05 [GenBank: NC_014842] [Browse all T4SS(s) in this replicon]
Location [Strand]71647..72270 [+]
Producttype-F conjugative transfer system pilin assembly protein TrbC
Component typeTrbC_F
UniProt IDE6WNS7
KEGG IDpao:Pat9b_4082
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 1.7e-25, Aligned region: 89..186
Protein Sequence: 207 a.a.     [Download]
>gi|317052852|ref|YP_004119618.1| type-F conjugative transfer system pilin assembly protein TrbC [Pantoea sp. At-9b]
MKTFLMTALMLSAVFPCAARTAVQPVVSGDDMAYMKQQQRDLELFKSQLQGMNITLPAAQEGRVAQLQND
IAASQADQNSASRTTPAAIYFVSLGIPEEGLLPMLADARRFGIPATLRGLLDNDFRKTASAMFELSKKDK
QAGVQIDPTLYQQFGIKAVPALVVTCGGKFDVLYGSLPVKQALEEVKQRGDCAGIAAQLLKNGEAAR
 
Nucleotide Sequence: 624 bp     [Download]
>gi|317052773|ref|NC_014842.1|:71647-72270 Pantoea sp. At-9b plasmid pPAT9B05, complete sequence
ATGAAAACCTTTCTGATGACGGCGCTGATGCTCAGTGCCGTGTTCCCGTGCGCGGCCCGTACCGCGGTGC
AACCTGTCGTGTCCGGCGACGATATGGCCTACATGAAACAGCAGCAGCGCGACCTTGAACTGTTTAAAAG
CCAGCTGCAGGGCATGAATATCACCCTGCCGGCGGCACAGGAGGGGCGCGTGGCGCAGCTGCAGAATGAT
ATCGCAGCGTCACAGGCGGACCAGAACAGCGCCAGCAGGACCACACCGGCGGCCATTTACTTTGTGAGTC
TGGGCATCCCGGAGGAAGGGCTGCTGCCGATGCTCGCAGACGCCCGCCGGTTCGGCATCCCGGCCACGCT
GCGCGGTCTGCTGGATAATGACTTCCGCAAAACCGCGTCGGCCATGTTTGAACTGTCAAAAAAAGATAAG
CAGGCCGGGGTGCAGATTGACCCGACACTGTATCAGCAGTTCGGCATTAAGGCGGTGCCGGCGCTGGTTG
TCACCTGTGGCGGAAAGTTCGACGTGCTCTACGGCAGCCTGCCGGTGAAACAGGCGCTGGAGGAAGTAAA
ACAGCGCGGTGACTGCGCCGGGATTGCCGCTCAGCTGCTGAAAAACGGGGAGGCAGCCCGATGA
 Primer design