SecReT4
Protein ID: 317052853
T4SS name [ID]Tra_F [127]
Gene symbol-
Locus tagPat9b_4083
StrainPantoea sp. At-9b plasmid pPAT9B05 (NC_014842)
Repliconplasmid pPAT9B05 [GenBank: NC_014842] [Browse all T4SS(s) in this replicon]
Location [Strand]72267..74105 [+]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDE6WNS8
KEGG IDpao:Pat9b_4083
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 1.5e-54, Aligned region: 319..560
Protein Sequence: 612 a.a.     [Download]
>gi|317052853|ref|YP_004119619.1| conjugal transfer mating pair stabilization protein TraN [Pantoea sp. At-9b]
MKRLLPFLLLAVVQCAVADDVSDAYNAGAAVAGSSKSQGTSAATGTDPSSVIPGYTASPSQRSYYGGVQG
GDGDISSKGQSALGQDDVGQSIISSGTTNPATTIDPTADFIQNGKNAEANSASITDGTNTQCTTKVVSKS
VFENYSCDRDVNQVQTCARTGTVTGHYEDTTTTETITIDSDSLAFDSNTLTVNWGPVPEGTVTSAVFTYT
FRKGLAYSNPVWFLNVTTLGQKLTMYDDSGSYTLASGLSLSAGDTLSFTLGNQANANNPGSIWTAGQANN
MYHFVLTLTIQKMDRKYVTDVTWSESCGFDKSTAIATAGTTCVDPGGDRTVTVDGQTYTQSADCWQYSDA
YIVPVSSTGNCATLMADRNCTLSARSCTESEGSTCLHEADTYQCQTTFSSEGLLCAGQYFCQAGDCSETD
GAGDSGFDTAVAKLAGLASAGEDVRDDQVNIKAFTGQALYCRKAMAGFSNCCVDTGWGNSAGLANCNSDE
MAIGKAKAKKVTVLVGEACNVSVMGVCVQKKQAYCVFQGKLARIIQEQGRRDQLHISFGSGDSPDCRGIT
VPELQSINFDLINFQDFYSDLMANQKIPDSATMVQQAKDRIAAQVAAQTGGK
 
Nucleotide Sequence: 1839 bp     [Download]
>gi|317052773|ref|NC_014842.1|:72267-74105 Pantoea sp. At-9b plasmid pPAT9B05, complete sequence
ATGAAAAGACTGCTTCCTTTTCTGCTGCTGGCTGTGGTGCAGTGTGCCGTCGCGGACGACGTCAGTGATG
CTTACAACGCCGGGGCGGCGGTTGCCGGCAGCAGTAAAAGTCAGGGGACGTCGGCGGCGACCGGGACCGA
CCCGTCCTCGGTTATTCCCGGCTACACGGCCAGCCCTTCGCAGAGAAGTTATTACGGCGGTGTGCAGGGC
GGAGACGGAGACATCAGCTCAAAGGGCCAGTCAGCGCTCGGGCAGGATGATGTAGGTCAGAGCATCATCA
GCTCCGGCACGACCAACCCCGCGACAACGATCGACCCGACGGCGGATTTTATTCAGAACGGAAAAAATGC
CGAGGCGAACAGCGCCAGCATCACGGACGGCACAAATACGCAGTGCACCACCAAAGTTGTATCGAAATCG
GTGTTTGAGAACTACAGCTGTGACCGGGATGTGAACCAGGTACAGACCTGCGCCCGCACGGGCACGGTAA
CGGGGCACTATGAAGACACCACGACTACGGAGACGATAACCATTGACTCGGATTCGCTGGCTTTTGATTC
GAACACGCTGACGGTGAACTGGGGGCCGGTGCCGGAAGGAACGGTGACCTCGGCCGTGTTTACCTATACG
TTCAGAAAAGGCCTGGCCTACAGCAACCCCGTCTGGTTTCTCAACGTGACCACGCTCGGCCAGAAGCTGA
CAATGTACGACGATTCCGGATCATATACCCTGGCGTCCGGGCTGAGTCTCAGTGCGGGCGATACCCTTTC
GTTCACCCTGGGCAATCAGGCCAACGCCAATAACCCCGGTTCAATCTGGACTGCGGGTCAGGCCAATAAC
ATGTATCACTTTGTGCTGACCCTTACGATACAGAAAATGGATCGTAAATATGTCACGGACGTGACCTGGT
CTGAATCCTGCGGTTTTGATAAATCCACCGCCATTGCCACTGCCGGAACAACCTGTGTGGACCCCGGAGG
AGACCGGACGGTGACCGTGGATGGGCAGACGTACACGCAGAGTGCCGACTGCTGGCAGTATTCGGATGCG
TATATCGTGCCGGTGAGCTCCACCGGGAACTGCGCCACGCTGATGGCGGACCGAAACTGCACACTGTCGG
CACGCAGCTGTACCGAATCTGAAGGCAGTACCTGCCTGCATGAGGCCGATACGTATCAGTGTCAGACGAC
CTTCAGTTCTGAAGGACTGCTGTGTGCCGGACAGTATTTCTGCCAGGCCGGTGACTGCAGTGAGACTGAC
GGGGCCGGTGACAGCGGTTTTGATACGGCGGTGGCCAAACTCGCCGGGCTGGCCTCGGCCGGTGAGGACG
TCAGGGATGATCAGGTCAACATAAAAGCCTTTACCGGGCAGGCGCTGTACTGCCGCAAGGCGATGGCGGG
CTTCTCCAACTGTTGTGTGGACACCGGCTGGGGCAACAGCGCCGGGCTGGCGAACTGTAACAGCGACGAG
ATGGCCATCGGTAAAGCCAAAGCGAAAAAGGTGACGGTACTGGTCGGCGAAGCCTGCAATGTTTCTGTGA
TGGGTGTCTGCGTGCAGAAAAAGCAGGCGTACTGCGTCTTTCAGGGCAAACTCGCCCGCATCATTCAGGA
ACAGGGGCGTCGCGACCAGCTGCACATCAGCTTCGGCAGCGGCGATTCACCCGACTGCCGCGGCATCACG
GTACCGGAGCTGCAGAGCATCAACTTCGACCTGATTAACTTCCAGGACTTCTACAGCGACCTGATGGCTA
ACCAGAAAATCCCGGATTCGGCGACGATGGTGCAGCAGGCAAAAGACCGCATTGCCGCGCAGGTGGCGGC
GCAGACGGGAGGGAAATAA
 Primer design