SecReT4
Protein ID: 317052854
T4SS name [ID]Tra_F [127]
Gene symbol-
Locus tagPat9b_4084
StrainPantoea sp. At-9b plasmid pPAT9B05 (NC_014842)
Repliconplasmid pPAT9B05 [GenBank: NC_014842] [Browse all T4SS(s) in this replicon]
Location [Strand]74105..74902 [+]
Producttype-F conjugative transfer system pilin assembly protein TraF
Component typeTraF_F
UniProt IDE6WNS9
KEGG IDpao:Pat9b_4084
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 9.8e-79, Aligned region: 38..255
Protein Sequence: 265 a.a.     [Download]
>gi|317052854|ref|YP_004119620.1| type-F conjugative transfer system pilin assembly protein TraF [Pantoea sp. At-9b]
MKKWLPGLLLLVCVTGAQADETPPPADAVVTPADPFTGWHWYNEPKKKPDTPAPKPPAPRVPDFSQLSPE
KQAEVLKGYTKQALDRAILYPSAENTATFLRWQKFWTDRASMFSQSFAVAQLDHPDLDYNLEHPHYNSTA
PLQQARDQEEQTQAISRLAGQYGLFYFYRGSDPIDAQMAGVVADFARLRRISLIPVSVDGTVSPQVPDSR
QDSGQSARMGISHFPALFLVDPATKDYRPLAYGFMTQDDLAKRFLNVATGFKPNF
 
Nucleotide Sequence: 798 bp     [Download]
>gi|317052773|ref|NC_014842.1|:74105-74902 Pantoea sp. At-9b plasmid pPAT9B05, complete sequence
ATGAAAAAGTGGTTACCTGGCCTGCTGCTCCTGGTCTGCGTGACCGGTGCACAGGCGGATGAAACGCCGC
CTCCCGCCGATGCGGTGGTGACGCCGGCCGACCCGTTTACCGGCTGGCACTGGTACAACGAGCCTAAGAA
AAAGCCGGACACCCCGGCGCCGAAACCACCGGCACCGCGCGTGCCGGACTTCAGTCAGCTTTCACCGGAG
AAGCAGGCGGAGGTGCTGAAGGGCTACACAAAACAGGCGCTGGACCGCGCCATTCTGTACCCCTCGGCGG
AAAACACGGCCACGTTCCTGCGCTGGCAGAAGTTCTGGACCGACCGCGCCTCGATGTTCAGTCAGTCGTT
CGCGGTGGCGCAGCTGGATCATCCGGATCTCGACTACAACCTGGAGCACCCGCACTACAACAGCACGGCC
CCGCTCCAGCAGGCGCGTGACCAGGAGGAGCAGACGCAGGCTATCAGCAGGCTGGCCGGGCAGTACGGGC
TGTTCTATTTCTACCGGGGTAGCGACCCGATTGATGCGCAGATGGCGGGCGTGGTGGCGGATTTTGCGCG
TCTGCGTCGCATCTCCCTCATCCCGGTCAGCGTGGACGGTACCGTGTCGCCGCAGGTGCCGGACAGCCGT
CAGGACAGCGGGCAGAGCGCGCGCATGGGGATCAGCCACTTCCCGGCGCTGTTTCTGGTGGACCCGGCCA
CGAAGGATTACCGGCCGCTGGCCTACGGCTTCATGACCCAGGATGACCTGGCGAAGCGCTTTCTTAACGT
GGCCACTGGTTTTAAACCCAACTTCTGA
 Primer design