SecReT4
Protein ID: 317052859
T4SS name [ID]Tra_F [127]
Gene symbol-
Locus tagPat9b_4089
StrainPantoea sp. At-9b plasmid pPAT9B05 (NC_014842)
Repliconplasmid pPAT9B05 [GenBank: NC_014842] [Browse all T4SS(s) in this replicon]
Location [Strand]76555..77922 [+]
ProductTraH family protein
Component typeTraH_F
UniProt IDE6WNT4
KEGG IDpao:Pat9b_4089
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 9.2e-116, Aligned region: 28..376
Protein Sequence: 455 a.a.     [Download]
>gi|317052859|ref|YP_004119625.1| TraH family protein [Pantoea sp. At-9b]
MNLRQLLLCAATALIISTPAMADVQGDLNGYFGSLGFDGNVSKAQAWQGQAAGYVTGGSVYLRNPVKQVQ
LISMQVPSLNAGCGGIDAYLGAFSFINGAELQRFVKQIMSNAAGYAFDLALQTMVPELKQAKDFLQKLAS
DVNSMNMSSCQAAQGIIGGLWPVSQVSNQKICQDIAGESNIFSDWAASRQGCTVGGQGDSVTSQASDAEK
DQVLKNKNLIWDALGRNHLFDGNRQLKELVMSVVGSIIFNKDGQVTILSPLVDNRDIITVLMRGGTAKIY
GCDEPDLCLGPTVEDVTVSSDVALVTQVRNLMISIDSKLSADTGLSDKEKGFINTTSVPVLKYLTNSRSM
GMSPTYLIQVADFIAQDMMIQYLQELVKQASQSLAGKNFPEQAAGELRNNVMAATSLLAQMKLQSTADQN
ALDGIDRNMQYLQQQVSTIISTSYQGNYQWGTGND
 
Nucleotide Sequence: 1368 bp     [Download]
>gi|317052773|ref|NC_014842.1|:76555-77922 Pantoea sp. At-9b plasmid pPAT9B05, complete sequence
ATGAATTTACGGCAGTTACTTCTTTGTGCTGCAACGGCGCTGATTATCAGTACGCCGGCGATGGCCGACG
TACAGGGCGACCTGAACGGCTATTTCGGCAGCCTCGGCTTTGACGGCAACGTCTCAAAGGCGCAGGCGTG
GCAGGGGCAGGCGGCCGGTTACGTGACCGGCGGCTCGGTCTATCTGCGTAACCCGGTCAAGCAGGTGCAG
CTTATCTCGATGCAGGTGCCGTCACTCAATGCGGGCTGCGGCGGGATTGATGCCTATCTGGGGGCCTTTT
CCTTCATCAACGGTGCCGAGCTGCAGCGCTTTGTGAAGCAGATTATGAGTAATGCCGCCGGTTATGCCTT
TGACCTGGCGCTGCAGACGATGGTCCCGGAGCTCAAGCAGGCCAAAGACTTCCTGCAGAAGCTGGCTTCG
GATGTGAACTCCATGAATATGAGTTCCTGTCAGGCCGCACAGGGGATCATCGGCGGCCTGTGGCCGGTCT
CGCAGGTATCGAACCAGAAAATCTGTCAGGACATTGCCGGGGAGAGCAATATCTTCTCGGACTGGGCGGC
ATCGCGGCAGGGCTGTACGGTGGGCGGGCAGGGTGACAGCGTCACCAGTCAGGCCTCTGACGCTGAAAAA
GACCAGGTGCTCAAGAACAAAAATCTTATCTGGGATGCGCTGGGACGTAACCACCTGTTTGACGGTAACC
GGCAGCTGAAAGAGCTGGTCATGAGCGTGGTGGGTTCCATCATCTTCAACAAGGACGGGCAGGTCACCAT
CCTCTCGCCGCTGGTTGATAATCGCGACATCATCACCGTGCTGATGCGCGGGGGAACCGCAAAAATCTAT
GGCTGCGATGAACCGGATCTCTGCCTGGGCCCGACCGTCGAAGACGTCACCGTCAGCAGTGACGTCGCAC
TGGTCACCCAGGTACGTAACCTGATGATTTCCATCGACAGCAAACTCAGCGCGGATACCGGCCTGTCGGA
TAAAGAGAAGGGCTTCATCAACACCACCTCGGTACCGGTGCTGAAGTACCTGACCAACTCGCGCAGCATG
GGCATGAGCCCGACCTACCTGATACAGGTGGCGGACTTCATCGCGCAGGACATGATGATCCAGTACCTGC
AGGAACTGGTGAAGCAGGCCAGCCAGTCACTGGCGGGCAAAAACTTCCCGGAGCAGGCGGCAGGCGAGCT
GCGCAACAACGTCATGGCCGCGACCTCGCTGCTGGCGCAGATGAAGCTGCAGTCCACAGCAGACCAGAAC
GCGCTGGACGGTATCGACCGCAACATGCAGTACCTTCAGCAGCAGGTCTCAACCATCATCTCAACGTCTT
ATCAGGGCAACTACCAGTGGGGGACCGGCAATGACTGA
 Primer design