SecReT4
Protein ID: 317052860
T4SS name [ID]Tra_F [127]
Gene symbol-
Locus tagPat9b_4090
StrainPantoea sp. At-9b plasmid pPAT9B05 (NC_014842)
Repliconplasmid pPAT9B05 [GenBank: NC_014842] [Browse all T4SS(s) in this replicon]
Location [Strand]77915..81028 [+]
ProductTraG domain-containing protein
Component typeTraG_F
UniProt IDE6WNT5
KEGG IDpao:Pat9b_4090
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 1e-114, Aligned region: 3..455
Protein Sequence: 1037 a.a.     [Download]
>gi|317052860|ref|YP_004119626.1| TraG domain-containing protein [Pantoea sp. At-9b]
MTEVWTIYGGDMWRQVFNGVVTIIGSDTFSTLKRIVGLFGVLGVMFSFIKSRNPMVFLHWVAIFFVITSV
LLVPKRSVQIIDITDPAAVYEVDNVPAGLAAIAGLATGAGFGVAQLYDYALARPDTLTYTKSGMLFGSQV
VAQSSDFRTQNPQLAQMLTDYVEDCVVGDILLNNKYTVAQLLNSTDPLTLITSNPSPLRGLYQDAGGGRQ
FITCQQAAVVIQNLIGSDISIGGTTWHALATRLFGSRVDANALLSSAMDDSYNFFYAGGLSASQIMRNNV
TNAAILDGWKGFAARSSDTANLLNLATESSLTKQRISWGAGGVIAARTLPMFQSLMMLVLIGLFPLVIAL
SLVNHSIFGLNTLKLYAGGFLYFQMWPVMFAILNSLANFYLQSKTGGTALVLANQDQVALQHSDAANIAG
YLSMSIPVLAFFLTKGAASVASQAVGGIMSSAAFATGGQASTTADGNWSFNNMSMDNVNANKFDTNMTRR
SGQQAFQTGNGSMHTQTADGHSVYDTSGAISNLPVNMRLSALASSGFSEQARQAQQQAQSSLDGYNHSVT
SGFQQMNQLTHQSGNSDSVTQGSDSSVATSVSRGASRMQSAVESYAKSHNVSEQQAYNQLMDITNQGGTG
ARGYVKFDSGDQLAGKLGKWATGLSAGGEGSVDWRHTSGSSHGTQDSHAEGRDNRHDRSSQEARDFREGM
DMVTSARLTESGSHTDNQSASQAQQFAATLNDAKSQYHQYTESSTRSQEFSRMATLSQTQSASLDANYNQ
EFVDWTTAKYGSDAQNILTNVRSAQGAATEFMHERLEPEIMRNYGARTDQVSGQPLQPTRSSDEPAMPLN
GDARIQAGSPVSGPDVLAGEHAGNVSNGGVREQHQVSAPGSIRQNGHEVTAGESQVPASGSALATVENVH
RRERNLTVPAGVPSQAMTDDFRSGSQRVSGQAAGAGIRSNVADRVAAQRSGLMETVRENDGKIAENKTTV
QTSSDILRNEHQGAVKSQQIGRTEEDLRQTRPWIDGSETDNFKEKLQRLREHQKKAS
 
Nucleotide Sequence: 3114 bp     [Download]
>gi|317052773|ref|NC_014842.1|:77915-81028 Pantoea sp. At-9b plasmid pPAT9B05, complete sequence
ATGACTGAAGTCTGGACCATTTACGGCGGGGACATGTGGCGGCAGGTGTTTAACGGCGTGGTCACCATCA
TCGGCTCGGATACGTTCAGCACGCTGAAGCGCATCGTCGGGCTGTTCGGCGTGCTGGGCGTGATGTTCAG
TTTTATCAAATCACGCAACCCGATGGTGTTTCTGCACTGGGTTGCCATCTTTTTTGTCATCACATCGGTG
CTGCTGGTACCGAAGCGCAGCGTGCAGATTATTGATATCACGGACCCGGCGGCGGTGTACGAAGTGGATA
ACGTGCCGGCAGGGCTGGCAGCCATTGCCGGTCTGGCGACGGGGGCCGGTTTCGGGGTGGCGCAGCTGTA
TGACTATGCGCTGGCCCGCCCGGACACCCTGACCTACACGAAGTCGGGAATGCTGTTTGGCTCGCAGGTG
GTGGCACAGTCGTCTGACTTCCGCACGCAGAACCCGCAGCTGGCGCAGATGCTCACCGACTACGTGGAAG
ACTGCGTGGTGGGCGATATTCTGCTGAACAACAAATACACCGTGGCGCAGCTGCTGAACAGCACCGACCC
GCTGACGCTCATCACCAGCAATCCGAGTCCGCTGCGCGGTCTGTACCAGGATGCGGGCGGCGGGCGCCAG
TTCATCACCTGCCAGCAGGCGGCGGTAGTCATTCAGAACCTGATCGGGTCCGATATCAGCATCGGCGGTA
CCACCTGGCACGCGCTGGCCACGCGCCTGTTTGGCAGCCGCGTTGACGCAAATGCCCTGCTGAGCAGCGC
GATGGATGACAGCTATAACTTTTTTTACGCCGGTGGACTGAGCGCCTCGCAGATTATGCGTAATAACGTT
ACCAATGCCGCCATCCTGGACGGCTGGAAAGGGTTTGCGGCGCGCTCGTCTGACACGGCCAACCTGCTCA
ACCTGGCCACGGAGTCCAGCCTGACCAAACAGCGCATCAGCTGGGGGGCAGGCGGGGTGATAGCGGCCCG
CACCCTGCCGATGTTCCAGTCGCTGATGATGCTGGTGCTGATAGGCCTGTTTCCGCTGGTGATTGCGCTG
TCGCTGGTCAACCACAGCATTTTCGGGCTGAACACGCTGAAACTCTACGCCGGGGGTTTTCTGTACTTCC
AGATGTGGCCGGTGATGTTTGCCATCCTGAACTCGCTGGCCAACTTCTACCTGCAGTCGAAGACCGGCGG
TACCGCGCTGGTGCTGGCGAATCAGGACCAGGTGGCGCTGCAGCATTCGGATGCGGCGAACATCGCGGGC
TACCTCAGCATGTCGATACCGGTGCTGGCGTTTTTCCTGACGAAAGGCGCAGCATCGGTGGCGTCGCAGG
CAGTGGGGGGCATTATGAGTTCGGCGGCGTTTGCGACCGGCGGGCAGGCGTCCACCACGGCAGACGGCAA
CTGGTCGTTCAACAACATGTCGATGGATAACGTCAACGCCAACAAGTTCGACACCAACATGACCCGCCGG
TCCGGGCAGCAGGCATTCCAGACCGGTAACGGCTCGATGCACACGCAGACGGCTGACGGACACAGCGTCT
ATGACACCAGCGGAGCGATATCGAACCTGCCGGTGAATATGCGGCTCAGCGCGCTGGCCAGCAGCGGTTT
CTCCGAGCAGGCACGGCAGGCGCAGCAGCAGGCGCAGAGTTCGCTGGACGGGTATAACCACAGCGTGACC
AGCGGCTTCCAGCAGATGAACCAGCTGACGCACCAGAGCGGGAACAGCGACAGTGTGACGCAGGGCAGCG
ACAGCAGCGTGGCCACCAGTGTAAGCCGCGGGGCCAGCAGAATGCAGTCGGCCGTGGAGAGCTACGCGAA
ATCGCATAATGTCTCGGAGCAGCAGGCGTATAACCAGCTGATGGATATCACCAACCAGGGGGGGACGGGT
GCCAGAGGCTATGTCAAATTTGACTCCGGCGACCAGCTGGCCGGTAAGCTCGGTAAGTGGGCCACCGGAC
TCAGCGCAGGTGGTGAAGGCAGCGTTGACTGGCGTCATACTTCCGGCAGCTCACACGGTACGCAGGACAG
CCATGCCGAGGGCCGCGACAACCGCCACGACCGGAGCAGTCAGGAAGCCCGCGACTTCCGCGAAGGTATG
GACATGGTGACATCTGCGCGCCTGACCGAGTCGGGCAGCCATACCGACAACCAGTCAGCCTCGCAGGCGC
AGCAGTTTGCGGCGACGCTCAACGATGCGAAGAGTCAGTACCACCAGTACACGGAGAGCAGTACGCGCAG
CCAGGAGTTCAGCCGCATGGCCACGCTGTCGCAGACGCAGAGCGCCAGCCTGGACGCCAACTACAACCAG
GAGTTTGTGGACTGGACGACCGCGAAGTACGGCAGCGACGCACAGAACATCCTGACCAACGTCAGAAGCG
CGCAGGGCGCGGCCACCGAGTTTATGCACGAACGGCTTGAGCCGGAAATCATGCGAAACTACGGTGCGCG
GACTGACCAGGTCAGTGGCCAGCCGCTGCAGCCGACCCGCTCGTCGGATGAGCCGGCTATGCCTCTTAAT
GGCGATGCCCGGATTCAGGCGGGTTCACCGGTGTCAGGTCCCGACGTGCTGGCAGGGGAACATGCCGGAA
ACGTCAGCAACGGCGGTGTTCGTGAGCAGCATCAGGTCTCTGCGCCGGGCAGCATAAGGCAGAACGGTCA
TGAAGTGACAGCTGGCGAATCGCAGGTTCCCGCCAGCGGAAGTGCCCTGGCGACTGTGGAAAATGTTCAC
CGCCGTGAGCGCAATCTTACCGTCCCGGCGGGTGTGCCGTCGCAGGCAATGACCGATGATTTCCGCAGCG
GTTCACAGCGCGTGAGCGGGCAGGCCGCAGGCGCGGGTATCCGGAGTAATGTGGCCGATAGGGTGGCAGC
ACAAAGATCTGGCCTGATGGAAACTGTCAGGGAAAATGACGGCAAAATCGCTGAAAATAAAACCACTGTT
CAGACGTCCAGTGATATACTCAGAAATGAGCATCAGGGTGCGGTTAAGAGTCAGCAGATAGGCCGGACGG
AAGAAGACTTGAGGCAGACTAGACCTTGGATTGACGGTAGCGAAACAGATAATTTTAAAGAGAAGCTTCA
ACGGCTTAGAGAGCATCAGAAAAAAGCCTCGTAA
 Primer design