SecReT4
Protein ID: 317052865
T4SS name [ID]Tra_F [127]
Gene symbol-
Locus tagPat9b_4095
StrainPantoea sp. At-9b plasmid pPAT9B05 (NC_014842)
Repliconplasmid pPAT9B05 [GenBank: NC_014842] [Browse all T4SS(s) in this replicon]
Location [Strand]83649..86291 [+]
Producttype IV conjugative transfer system coupling protein TraD
Component typeTraD_F
UniProt IDE6WNU0
KEGG IDpao:Pat9b_4095
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 9.5e-141, Aligned region: 180..568
TraG-D_C [PF12696], Evalue: 1.3e-19, Aligned region: 426..549
TraD_N [PF12615], Evalue: 1.3e-12, Aligned region: 31..136
AAA_10 [PF12846], Evalue: 1.1e-11, Aligned region: 195..233
AAA_10 [PF12846], Evalue: 1.1e-11, Aligned region: 403..505
T4SS-DNA_transf [PF02534], Evalue: 3.6e-11, Aligned region: 337..548
Protein Sequence: 880 a.a.     [Download]
>gi|317052865|ref|YP_004119631.1| type IV conjugative transfer system coupling protein TraD [Pantoea sp. At-9b]
MSFTPKNLTQGGQMTAYRLRMFGQVSNWIFHWILLLFIAAVAVLFWLTTPDDVLRNGFWYWAAWPSHSLL
GLAPGTTTATWDILWHCGDGTSLCTTKMTPVQLLADPWMQAMGDAFVASLKFLATVCGITAFALWCLIAW
FVGRIGKKESEDEFISGMTLTDQPKEVNRLLKKAGEKSDLQIGGLHMVKNAEVMNFLIHGTIGVGKSTLI
RWLLDYIRRRGDRAIIYDSGGTFIETHYNPRRDKILNPHDSRCENWVLWRECREVVDYENLTAALMPVEG
DSDPFWVSSSRTIFSDGAMQFAADPARSIETFLKTLLSIDLKSLREFLKNTPSANLVEEKIEKTAISIRS
VLTNYAKSLRYLQGLDKEGKPEFSIREWMTGAQYDSSWLFISTTARHRRAVRPLISMWLSLATLLLQSMG
ENSGRRVWFIGDEIASLQKIPELNETLAEARKFGGCFVLGVQNIPQLVHIYGREMAKAIFDLLNTRAYGR
SPSAEVAKMVEEELGHQRRREAREQNSYGLDQVRDGISISKDKVNEPVVDYDLIMKMPNLRFYMRLPGEY
PVVKLSLKYRKQRKSHRALIERDFRDRLSPELERIIESNERSARAADISFPTGEEILEAGNVQSVQKVPE
PVAVPASPVTVRKVTDTTPAPGGADIARDTLPVIKPFLPEASLPAPVRETSAGREDLPANVRPFPARQAV
PVTAPYVTEARRPQARSAESRSGHDATVPSHTPALLPEVRPEAVPAVPVPPVFPSPRPAAQPVKPSRPAP
TALSALDMLARRTKKPAAAESDADASSGDAQGEAPELNMQAEKDEAGRLTVRSAGHRKTDPESREEAYAA
QYGRANQQMADEELNILRHREDDETYQAMSQHHEPGGHER
 
Nucleotide Sequence: 2643 bp     [Download]
>gi|317052773|ref|NC_014842.1|:83649-86291 Pantoea sp. At-9b plasmid pPAT9B05, complete sequence
ATGAGTTTCACCCCGAAAAACCTCACGCAGGGCGGCCAGATGACGGCCTACCGCCTGCGCATGTTTGGTC
AGGTCAGCAACTGGATATTTCACTGGATACTGCTGCTGTTCATTGCCGCCGTGGCGGTGCTGTTCTGGCT
GACCACGCCCGATGACGTGCTGCGAAACGGCTTCTGGTACTGGGCCGCGTGGCCGTCTCATTCGCTGCTG
GGGCTCGCCCCCGGCACCACTACGGCCACCTGGGACATCCTGTGGCACTGCGGTGACGGGACGTCGCTGT
GCACCACGAAAATGACTCCGGTACAGCTGCTGGCCGATCCGTGGATGCAGGCAATGGGTGACGCGTTTGT
GGCCAGCCTGAAATTTCTGGCGACGGTCTGCGGCATCACGGCCTTTGCCCTGTGGTGCCTGATCGCCTGG
TTCGTGGGGCGCATCGGGAAAAAGGAGAGCGAGGACGAGTTCATCTCCGGCATGACGCTGACCGACCAGC
CAAAAGAAGTGAACCGTCTGCTGAAGAAGGCGGGCGAGAAGTCCGACCTGCAGATTGGCGGGCTACATAT
GGTGAAGAACGCCGAGGTGATGAACTTCCTCATCCACGGCACCATCGGTGTCGGTAAGTCCACGCTCATC
CGCTGGCTGCTGGACTACATCCGTCGCCGCGGTGACCGCGCCATTATCTATGACTCCGGCGGCACCTTCA
TTGAAACGCACTACAACCCGCGCCGCGACAAAATCCTCAACCCGCACGACAGCCGCTGTGAAAACTGGGT
GCTGTGGCGCGAGTGTCGGGAAGTGGTTGATTACGAGAACCTGACGGCGGCGCTGATGCCGGTGGAGGGG
GACTCTGATCCGTTCTGGGTGTCTTCCTCGCGCACCATCTTCAGCGACGGTGCGATGCAGTTCGCGGCCG
ACCCGGCGCGCAGCATTGAGACGTTCCTGAAGACCCTGCTCTCCATTGACCTGAAAAGCCTGCGCGAATT
TCTGAAGAACACGCCGTCGGCCAACCTGGTCGAGGAAAAAATCGAGAAGACGGCCATCTCCATTCGTTCG
GTGCTCACCAACTACGCCAAATCGCTGCGTTATCTGCAGGGGCTGGATAAAGAGGGCAAGCCGGAGTTCA
GCATCCGCGAGTGGATGACCGGTGCGCAGTACGACAGCAGCTGGCTGTTTATCTCCACCACGGCCCGCCA
CCGCAGGGCGGTGCGTCCGCTGATTTCCATGTGGCTGTCGCTGGCCACGCTGCTGCTGCAGAGCATGGGC
GAGAACAGCGGGCGCCGCGTGTGGTTCATCGGTGATGAAATCGCCAGCCTGCAGAAAATCCCCGAGCTCA
ACGAAACGCTGGCGGAGGCCCGCAAGTTCGGCGGCTGTTTTGTGCTGGGTGTCCAGAACATCCCGCAGCT
GGTGCACATCTACGGTCGCGAGATGGCCAAAGCCATTTTCGACCTGCTGAACACCCGTGCTTACGGGCGT
TCACCCAGTGCTGAGGTGGCGAAGATGGTAGAGGAGGAACTGGGTCACCAGCGCCGGCGCGAGGCGCGTG
AGCAGAACAGTTACGGCCTGGATCAGGTCCGTGACGGTATCTCCATCAGCAAAGACAAGGTCAATGAGCC
CGTCGTGGACTACGACCTGATCATGAAAATGCCGAACCTGCGCTTTTACATGCGCCTGCCGGGTGAGTAT
CCGGTGGTGAAGCTCAGCCTGAAATACCGGAAGCAGAGAAAGTCTCACCGGGCGCTCATTGAACGTGACT
TCCGCGACCGGCTGAGTCCGGAGCTTGAGCGGATCATCGAGAGCAACGAGCGCAGCGCCCGCGCGGCAGA
CATTTCGTTCCCGACCGGGGAGGAAATTCTGGAAGCCGGCAACGTGCAGTCAGTACAGAAAGTCCCTGAA
CCGGTGGCAGTTCCCGCCAGCCCCGTGACGGTCAGGAAGGTGACGGATACCACGCCGGCGCCGGGCGGGG
CAGACATCGCGCGGGACACCCTGCCTGTCATTAAGCCTTTTTTACCGGAGGCGTCACTGCCGGCTCCGGT
CCGTGAAACGTCAGCGGGCAGGGAGGATCTTCCTGCAAACGTCAGACCGTTCCCGGCCCGTCAGGCTGTT
CCGGTCACTGCCCCTTATGTGACTGAGGCACGGCGCCCGCAGGCGCGGTCCGCAGAAAGCCGGTCCGGGC
ATGACGCGACTGTCCCGTCACACACGCCGGCACTTCTCCCGGAGGTCCGGCCGGAAGCGGTCCCTGCAGT
GCCGGTACCTCCCGTTTTCCCGTCGCCACGCCCGGCTGCTCAGCCTGTAAAACCCTCACGCCCGGCACCG
ACAGCCCTGAGCGCGCTGGACATGCTGGCCCGCCGGACAAAAAAGCCAGCGGCCGCAGAGAGTGACGCTG
ACGCGTCCTCCGGTGACGCGCAGGGGGAGGCCCCGGAACTGAACATGCAGGCGGAAAAGGATGAGGCCGG
CAGGCTGACCGTGCGCAGCGCCGGGCACCGTAAAACCGACCCGGAGAGCCGGGAAGAAGCGTATGCCGCG
CAGTACGGCAGGGCAAATCAGCAGATGGCGGATGAGGAGCTGAACATCCTGCGCCATCGCGAAGATGACG
AAACGTATCAGGCCATGAGTCAGCACCATGAACCCGGAGGACATGAGCGATGA
 Primer design