SecReT4
Protein ID: 317052866
T4SS name [ID]Tra_F [127]
Gene symbol-
Locus tagPat9b_4096
StrainPantoea sp. At-9b plasmid pPAT9B05 (NC_014842)
Repliconplasmid pPAT9B05 [GenBank: NC_014842] [Browse all T4SS(s) in this replicon]
Location [Strand]86288..92104 [+]
Productconjugative transfer relaxase protein TraI
Component typeTraI_F
UniProt IDE6WNU1
KEGG IDpao:Pat9b_4096
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 2.1e-75, Aligned region: 7..272
AAA_30 [PF13604], Evalue: 1.1e-45, Aligned region: 1064..1253
TraI [PF07057], Evalue: 3.2e-39, Aligned region: 1503..1620
AAA_19 [PF13245], Evalue: 3.1e-07, Aligned region: 1076..1140
UvrD_C_2 [PF13538], Evalue: 3.4e-05, Aligned region: 1409..1513
Protein Sequence: 1938 a.a.     [Download]
>gi|317052866|ref|YP_004119632.1| conjugative transfer relaxase protein TraI [Pantoea sp. At-9b]
MMTIAPVASAADAAGYYSSKDNYYFLDDLQSQWLGEGARELGLEGPVDLDTFTAVLHGKLPNGVEMGKDV
QGSHVHRPGHDLTFSAPKSISMLILAGGDKRLLAAHHEAVKETLALVEQMVSARDTRDGVTRITATGKMV
AALFTHDTSRNLDPQIHTHAVLANVTELEGKWKALATDTIHGAGFIETLYRYQVSFGKLYRTALKGKTEA
LGYETEFTGGKHELWEVKGFTDAVLEEFSSRHREISARVGEEASLKSRDVAALDTRRPKQDISRLDDGQP
VPQGEQPVTSPAGDNRTPDTVPPERAVQPQTLSRSDAPEQGEPDAPDGRAVARTAEQENTLPEAPGAEQE
APQPGERPPGRDSMNEQAGPDQEPPIEKPETPDGRARLHERWQRQMDSVDFDIGGVMRDAREREAARTEP
GEEPPLPGEVMDAVRTAISVLSDSRTRFTYGDLLLTAHQAGEQQHSIPELRRALDQAISDNLLAPLDGDK
GVFTSHIHLLDELSVQSLAADIIKENRVANFRESPGMTPEHLKQAQRAPVAILNAPASVQRLRDTVEELV
TMSRENGREVSVLASGAERALTLGKSALLKDTLLQRSRVTEKTFSLAPQSTLIIEGAEKLGLKEMLVLTG
EAREKNAQLLFLDSAGRQSNTNALSVLASAGVERLSLTAPGPGLEARVFSIQDKRDRYRALAERFTDLSG
PDNTVTAAVTGAREQQQLTGYIRDALQNAGKLGRDTVQVEARTPVFITAKERKLPVSYRPGMVLEDRSDR
QEIRHYMIDRVHDDTRMLSLIDGDGVLSRVKLSTLTADWRLFTREQLSIAQGEQLFALAADRSAGLKARD
RLTVTALENGALTVMREGQQKPLRIATDRPLYVTHGYVSAPGARDNERGTVLASLSSRELSVNMMNALAQ
SGTEAEIFTGEALNRAEEKMMRLRTGRSPVALVRQASGREDVSDALETLNANLLSDAEKAVSRAVAQMRH
VSFSEVKLLEGAEDFLENVPALRTEIARQVKAGDLMPVKVSGEPRFVSRATWEMEKAIIGEIAAGKNAVE
PLMATIAPSLLTGLTAGQQAATTLILQSPDRFTAVQGYAGTGKTTQFKAVKAAIETLPESGRPLIIGLAP
THRAVKEMRDTGIEAQTLKSFVLDWQQRTAAGEEVRYGNTLFLIDESSMLGNQDTAAAYRAIAAGDGRAV
PVGDVAQLESPESGAPFRLMQERSPIDVAVMKEIVRQRDANLKSAVYSVIENKAAAALEKINRVSPGTVP
REAGEVVPLRSVTETGSPVSNIVADYIGRTKAAREQTMIVVQLHEDRRAINEGIHASMVQRKELGEKAVT
VPVLDRITGGRHDFNRIGDWKAGQVVLANERYLTVTGADRGTGHVLLRDESGRMQYWSPAELNATEIEVF
ERREIELREGDSVRLNKTQKQAGHAAHEQYRVAELRENGEIVLKNRDGEKVIDPKAVTADRHVDYAWAVT
GYGAQGASTDYVIALEGTEGARANMSGMRAFYISASRAKDHVQIYTDGLKDWLETLQGGKNGPATAHDAL
SPEPERAQARAIWAMGQPLSKTALGRAFLRGQGLKGAPLTARIIPPTKKYPDAHLALPVYDGNGKTAGLT
LVPLTAEAGQPEPGEVRQLITGGAQAAIVQKSRDGEMIIVSDLQQALAAARNKPQAGVLLLTGRHPPSAQ
LLKVAGGQPGRGWRPDATLLRLVQAELREGLRDLPPDAPVPDERAALRAALDALEKGQETGQNVPSAPGR
DSAQENSRDVRAIAQQLTEGAMASPGTVPVVTERDRAQLSALLAMRVVEAMKQQLPSLPGEPVPDYAALV
RQASAALAAEAGGPDSAAVRAVLDILSGVSLPQEPGISATTGQGDSIPAGVLKQVREEIARERVPPGAPQ
QQALSESTLAGVARELERRPELPSDIRGREPEREELTRESVRHIQKER
 
Nucleotide Sequence: 5817 bp     [Download]
>gi|317052773|ref|NC_014842.1|:86288-92104 Pantoea sp. At-9b plasmid pPAT9B05, complete sequence
ATGATGACCATTGCACCGGTGGCGTCCGCCGCGGACGCGGCCGGTTACTACAGCAGCAAGGATAACTACT
ATTTCCTGGACGATCTGCAGAGCCAGTGGCTGGGCGAAGGGGCCCGTGAACTGGGTCTGGAAGGCCCGGT
GGACCTGGACACCTTTACCGCCGTACTGCACGGAAAATTGCCCAACGGGGTGGAAATGGGTAAGGACGTG
CAGGGCAGTCACGTTCACCGCCCCGGGCATGACCTGACGTTTTCGGCCCCGAAAAGCATCTCCATGCTCA
TTCTGGCCGGGGGGGATAAACGTCTGCTGGCCGCCCACCATGAGGCGGTAAAGGAAACGCTGGCGCTGGT
TGAGCAGATGGTAAGCGCCCGTGACACCCGGGACGGGGTGACCCGCATCACGGCGACCGGGAAAATGGTG
GCCGCCCTGTTCACGCACGACACCTCACGTAATCTTGACCCGCAGATCCACACCCATGCGGTGCTGGCCA
ACGTGACAGAGCTGGAGGGGAAGTGGAAGGCGCTGGCCACGGACACCATTCACGGGGCCGGGTTTATCGA
AACCCTTTACCGCTATCAGGTGTCATTCGGAAAGCTGTACCGCACCGCGCTGAAAGGGAAAACCGAGGCG
CTGGGGTATGAGACGGAATTCACCGGCGGAAAGCATGAGCTGTGGGAGGTGAAAGGTTTCACCGACGCCG
TACTGGAGGAGTTTTCCTCCCGGCACCGCGAAATCAGCGCGCGCGTGGGTGAGGAAGCGTCGCTGAAAAG
CCGCGACGTGGCGGCGCTTGACACCCGGCGGCCCAAACAGGATATCAGCCGGCTGGATGACGGCCAGCCG
GTCCCACAGGGTGAGCAGCCCGTGACTTCGCCGGCAGGAGATAACAGGACCCCGGATACCGTGCCGCCCG
AACGGGCTGTTCAGCCGCAGACGCTCAGCCGTTCCGATGCACCTGAGCAGGGCGAGCCAGACGCGCCTGA
CGGTCGCGCGGTTGCCCGCACTGCTGAGCAGGAGAACACGCTGCCAGAGGCACCGGGCGCGGAGCAGGAA
GCCCCTCAGCCGGGAGAACGTCCGCCCGGCCGCGACAGCATGAATGAACAGGCCGGGCCTGACCAGGAAC
CTCCCATCGAAAAACCGGAAACCCCGGACGGCAGAGCCCGCCTGCACGAACGCTGGCAGCGTCAGATGGA
CAGCGTGGATTTTGACATTGGGGGAGTGATGCGTGATGCCCGTGAACGCGAGGCGGCACGGACGGAGCCC
GGAGAGGAACCACCCCTGCCGGGTGAAGTGATGGACGCCGTGCGCACCGCCATTTCGGTACTGAGCGACA
GCCGGACGCGCTTTACTTACGGCGACCTGCTGCTGACGGCCCACCAGGCCGGTGAGCAGCAGCACAGCAT
CCCGGAGCTGCGCCGCGCGCTGGACCAGGCCATCAGTGACAACCTGCTGGCCCCGCTGGACGGGGATAAA
GGCGTGTTCACCTCCCACATTCACCTGCTGGATGAGCTGTCCGTGCAGTCACTGGCGGCCGATATCATAA
AGGAGAATCGCGTGGCGAACTTTCGTGAATCCCCCGGCATGACGCCGGAACATCTGAAACAGGCGCAGCG
AGCACCGGTGGCCATCCTGAACGCCCCGGCGTCGGTACAGCGCCTGCGCGATACGGTGGAGGAACTGGTG
ACAATGTCACGGGAAAACGGCCGGGAAGTCAGCGTCCTGGCCTCGGGTGCCGAACGCGCCCTGACCCTCG
GCAAATCGGCGCTGCTGAAAGATACCCTGCTGCAGCGCAGCCGCGTCACGGAGAAAACCTTCAGCCTGGC
GCCCCAGAGCACGCTGATTATTGAGGGGGCGGAGAAGCTGGGGCTGAAGGAGATGCTGGTCCTGACCGGC
GAGGCGCGGGAGAAGAACGCCCAGCTGCTGTTTCTCGACAGCGCCGGCCGCCAGTCGAACACGAATGCCC
TGTCGGTGCTGGCCTCGGCCGGCGTTGAACGCCTCAGCCTGACGGCCCCCGGACCGGGGCTGGAGGCGCG
CGTTTTCAGCATTCAGGACAAACGTGACCGCTACCGTGCTCTGGCAGAGCGCTTTACCGACCTGAGCGGC
CCGGACAATACGGTCACGGCGGCCGTGACCGGCGCGCGTGAACAGCAGCAACTGACGGGGTACATCCGCG
ATGCGCTGCAGAATGCCGGGAAGCTCGGCCGTGACACCGTGCAGGTGGAGGCGCGCACGCCGGTCTTCAT
CACGGCGAAAGAGCGGAAGCTGCCGGTATCGTACCGGCCCGGCATGGTGCTGGAGGACCGCAGCGACCGG
CAGGAAATCCGCCACTACATGATTGACCGGGTACATGACGACACCCGAATGCTGTCGCTTATCGACGGTG
ACGGCGTGCTGAGCCGGGTAAAACTCAGCACCCTCACCGCCGACTGGCGTCTGTTCACCCGGGAACAGCT
GAGTATCGCGCAGGGTGAGCAGCTGTTCGCGCTGGCCGCAGACCGGTCTGCCGGGCTGAAGGCGCGCGAC
CGTCTGACCGTCACGGCGCTGGAGAACGGGGCGCTGACGGTGATGCGGGAGGGGCAGCAGAAGCCGCTGC
GCATCGCCACGGACCGCCCCCTGTACGTCACCCACGGGTACGTCAGCGCGCCGGGCGCGCGGGATAACGA
ACGGGGCACGGTGCTGGCGAGCCTGAGCAGCCGGGAGCTGTCAGTCAACATGATGAACGCCTTGGCGCAG
TCCGGCACTGAGGCCGAAATCTTTACCGGAGAGGCACTGAACCGGGCGGAGGAGAAGATGATGCGGCTGC
GCACCGGCCGTTCCCCGGTGGCGCTGGTCAGACAGGCCAGCGGCCGGGAGGACGTCAGCGACGCGCTGGA
GACGCTGAATGCGAACCTGCTGTCGGATGCGGAGAAGGCCGTATCCCGCGCCGTGGCGCAGATGCGCCAT
GTGTCCTTTTCCGAGGTGAAACTTCTGGAGGGAGCGGAGGACTTTCTGGAGAACGTGCCGGCGCTCCGGA
CCGAAATTGCCCGACAGGTGAAAGCCGGTGACCTGATGCCGGTGAAGGTCAGCGGCGAGCCGCGCTTTGT
CTCCCGCGCAACGTGGGAAATGGAAAAGGCGATTATCGGGGAGATTGCGGCCGGCAAGAACGCGGTCGAG
CCGCTGATGGCCACCATTGCCCCGTCCCTTCTCACCGGACTCACCGCCGGGCAACAGGCGGCCACCACGC
TCATTCTGCAGAGTCCCGACCGCTTTACGGCGGTACAGGGGTACGCCGGGACGGGTAAAACCACGCAGTT
TAAGGCGGTGAAGGCGGCCATTGAGACCCTGCCGGAGAGCGGGCGTCCGCTGATTATCGGGCTGGCTCCC
ACACACCGTGCGGTCAAAGAGATGCGCGATACCGGCATAGAGGCGCAGACGCTGAAGTCGTTCGTGCTGG
ACTGGCAGCAGCGTACCGCCGCCGGTGAAGAGGTCCGCTACGGCAATACCCTGTTTCTCATCGATGAGTC
CTCGATGCTGGGCAACCAGGACACCGCTGCAGCGTACCGCGCGATTGCGGCCGGTGACGGGCGCGCCGTG
CCGGTCGGGGACGTGGCGCAGCTGGAGTCCCCGGAGAGCGGTGCCCCGTTCCGGCTGATGCAGGAGCGCA
GCCCCATCGATGTCGCCGTGATGAAAGAGATTGTGCGCCAGCGCGACGCAAACCTGAAATCCGCCGTCTA
CAGCGTGATTGAAAACAAGGCGGCCGCCGCGCTGGAGAAAATCAACCGGGTGTCGCCGGGGACGGTGCCG
CGGGAAGCCGGTGAGGTGGTCCCGTTACGCTCGGTGACGGAGACGGGCTCCCCGGTCAGCAACATCGTGG
CGGATTATATCGGCCGCACAAAAGCAGCCCGGGAGCAGACGATGATCGTGGTGCAGCTGCATGAGGACCG
TCGCGCCATCAATGAGGGTATCCACGCCAGCATGGTGCAGCGAAAAGAGCTGGGCGAAAAAGCCGTCACG
GTGCCGGTACTGGACCGCATCACCGGCGGCCGCCACGACTTTAACCGTATCGGGGACTGGAAGGCCGGGC
AGGTGGTGCTGGCAAACGAACGCTACCTGACCGTGACCGGCGCTGACCGGGGAACCGGGCATGTGCTGCT
GCGGGATGAAAGCGGGCGGATGCAGTACTGGTCGCCGGCGGAGCTTAACGCCACCGAAATCGAGGTGTTT
GAGCGGCGTGAAATCGAGCTGAGGGAAGGCGACAGCGTGCGCCTGAACAAAACGCAGAAACAGGCAGGTC
ATGCCGCGCACGAGCAGTACCGCGTGGCGGAACTGCGGGAGAACGGTGAGATCGTACTGAAGAACAGGGA
CGGTGAAAAGGTCATTGACCCGAAGGCCGTCACGGCAGACCGGCATGTGGACTATGCCTGGGCGGTGACC
GGTTACGGCGCACAGGGGGCAAGTACCGACTACGTGATCGCGCTGGAGGGAACGGAAGGGGCCCGCGCGA
ACATGAGCGGAATGCGGGCCTTTTACATCAGCGCCTCGCGCGCGAAGGACCATGTGCAGATTTACACTGA
CGGCCTGAAAGACTGGCTGGAGACCCTGCAGGGTGGGAAGAACGGTCCGGCAACGGCGCATGATGCCCTG
TCACCGGAGCCTGAGCGGGCTCAGGCCCGGGCCATCTGGGCGATGGGGCAACCTCTGTCGAAAACGGCGC
TCGGTCGCGCCTTCCTGCGCGGGCAGGGGCTGAAGGGGGCACCGCTCACCGCCCGGATTATCCCGCCGAC
AAAAAAATACCCGGACGCGCATCTGGCGCTGCCGGTGTATGACGGCAACGGCAAGACGGCGGGGCTGACG
CTGGTTCCGCTGACAGCGGAAGCCGGCCAGCCTGAGCCGGGTGAGGTGCGTCAGCTTATCACCGGTGGTG
CACAGGCTGCCATCGTGCAGAAAAGCCGGGACGGAGAGATGATCATCGTCAGTGACCTCCAGCAGGCGCT
GGCGGCCGCACGGAATAAGCCACAGGCGGGCGTGCTGCTGCTGACCGGGCGTCATCCGCCGTCGGCCCAG
TTACTGAAAGTGGCCGGTGGCCAGCCCGGGCGGGGCTGGCGTCCCGATGCCACACTGCTGCGTCTGGTAC
AGGCTGAGCTCCGGGAGGGGCTGCGCGACCTGCCGCCGGATGCACCGGTACCCGATGAGCGTGCCGCACT
GCGTGCAGCCCTGGACGCACTGGAAAAAGGCCAGGAAACCGGTCAGAACGTTCCGTCCGCGCCAGGACGG
GACAGTGCTCAGGAGAACAGCCGTGACGTGCGTGCCATTGCACAGCAGCTGACAGAGGGTGCGATGGCCA
GCCCGGGCACCGTCCCGGTGGTGACGGAACGGGACAGGGCACAGCTGTCTGCGCTGCTGGCCATGCGGGT
GGTGGAGGCGATGAAGCAGCAACTGCCGTCCCTGCCCGGCGAACCCGTACCGGACTATGCCGCTCTGGTC
AGACAGGCCTCAGCTGCACTGGCGGCCGAAGCCGGTGGCCCGGACAGTGCGGCTGTCCGGGCCGTTCTGG
ACATCCTGTCCGGCGTCTCGCTGCCGCAGGAGCCGGGAATTTCTGCCACTACCGGCCAGGGTGACAGCAT
ACCGGCAGGGGTACTGAAGCAGGTCCGGGAGGAGATTGCACGCGAGCGGGTACCGCCCGGGGCACCACAA
CAGCAGGCGCTGTCAGAAAGTACACTGGCCGGCGTGGCCCGTGAGCTTGAACGGCGGCCGGAGCTGCCGT
CAGACATACGGGGCCGGGAACCGGAACGTGAAGAGCTGACACGCGAGAGCGTCCGGCATATCCAGAAAGA
ACGCTGA
 Primer design