SecReT4
Protein ID: 317053480
T4SS name [ID]Tra_F [126]
Gene symbol-
Locus tagPat9b_4721
StrainPantoea sp. At-9b plasmid pPAT9B02 (NC_014839)
Repliconplasmid pPAT9B02 [GenBank: NC_014839] [Browse all T4SS(s) in this replicon]
Location [Strand]65..2677 [+]
Producttype IV conjugative transfer system coupling protein TraD
Component typeTraD_F
UniProt IDE6WKX3
KEGG IDpao:Pat9b_4721
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 2.7e-139, Aligned region: 180..568
TraG-D_C [PF12696], Evalue: 2.4e-19, Aligned region: 426..549
TraD_N [PF12615], Evalue: 2.8e-13, Aligned region: 31..136
T4SS-DNA_transf [PF02534], Evalue: 1e-11, Aligned region: 338..511
AAA_10 [PF12846], Evalue: 4.3e-09, Aligned region: 406..505
Protein Sequence: 870 a.a.     [Download]
>gi|317053480|ref|YP_004118614.1| type IV conjugative transfer system coupling protein TraD [Pantoea sp. At-9b]
MSFTPKNLTQGGQMTAYRLRMFGQVSNWIFHWILLLFIAAVAVLFWLTTPDDVLRNGFWYWAAWPSHSLL
NLAPGTTTATWDILWHCGDGAQLCTTKMTPAQLLADPWMRSMGDAFLAGLKFLATVCGITAFVLWCLIAW
YVGRIGKKESEDEFISGMTLTDNLQEVNRQLKKAGEKSDLQIGGLHMVKNAEVMNYLIHGTIGVGKSTPI
RWLLDYIRRRGDRAIVYDSGGTFIETHYDPSRDKILNAHDRRCENWVLWREARDVVDYENMTAALMPVEG
DSDPFWVSSSRTIFSDTAMQFASRPDRSIETFLKTCLSIDLKSLREFLKNTPSANLVEEKIEKTAISIRS
VLTNYAKSLRYLQGLDKEGKPEFSIREWMTDAQYDSSWLFIATTARHRKAVRPLISMWLSLATLLLQSMG
ENSDRRVWFIGDEIASLQKIPELNETLAEARKFGGCFVLGIQNIPQLVHIYGREMAKAIFDLLNTRAYGR
SPSAEVAKMVEEELGHQRRREAREQNSYGLDQVRDGIAISKDRVNEPIVDYDLIMKMPNLRFYIRLPGEY
PVVKLSLKYRPQKKHHPALIERDFRDRLSPELEAIISGNERAAVAADIRFPTGEEILEAGNVQSVQKVPE
PVAVPASPVTVRKVTDTTPVPGGTDIARDTRPVIMPFLPEASLPPSVRETSAGRGDLPTNVRPFPARQGI
PVTAPDVTEALLSQARSAESRSGHDATVPSHTPAPLPEVRPAPSPAAPAPPVSPQSRPAPAALSALDMLA
RRTKKPAAAESDADASSGDAQGEAPELNMQAEKDEAGRLTVRSAGHRKTDPESREEAYAAQYGRANQQMA
DEELNILRHREDDEAYQAMSQHHEPGGHER
 
Nucleotide Sequence: 2613 bp     [Download]
>gi|317053479|ref|NC_014839.1|:65-2677 Pantoea sp. At-9b plasmid pPAT9B02, complete sequence
ATGAGTTTCACCCCGAAAAACCTCACGCAGGGCGGCCAGATGACGGCCTACCGCCTGCGCATGTTTGGGC
AGGTCAGCAACTGGATATTTCACTGGATACTGCTGCTGTTCATCGCTGCCGTGGCGGTGCTGTTCTGGCT
GACCACGCCCGACGACGTGCTGCGTAACGGCTTCTGGTACTGGGCGGCGTGGCCGTCTCATTCCCTGCTG
AATCTCGCACCCGGCACCACCACGGCCACCTGGGACATCCTGTGGCACTGCGGCGACGGGGCGCAGCTGT
GCACCACGAAGATGACGCCGGCACAGCTGCTGGCAGATCCCTGGATGCGGTCGATGGGCGACGCGTTTCT
GGCCGGCCTGAAGTTTCTGGCAACGGTCTGCGGCATTACCGCCTTTGTCCTGTGGTGCCTGATTGCCTGG
TACGTGGGGCGCATCGGGAAGAAGGAGAGCGAGGACGAGTTTATTTCCGGCATGACGCTGACGGACAACC
TGCAGGAGGTGAACCGCCAGCTGAAGAAGGCGGGAGAAAAATCCGACCTGCAGATTGGTGGCCTGCATAT
GGTGAAGAACGCCGAGGTCATGAACTATCTCATTCACGGCACCATCGGCGTGGGCAAATCGACGCCCATC
CGCTGGCTGCTGGACTACATCCGCCGGCGCGGTGACCGCGCGATCGTTTACGACTCAGGCGGCACCTTCA
TTGAGACGCACTATGACCCAAGCCGCGACAAGATCCTGAACGCGCACGACCGCCGCTGTGAGAACTGGGT
GCTGTGGCGCGAGGCGCGTGACGTGGTCGATTACGAGAACATGACGGCGGCGCTGATGCCGGTGGAGGGC
GACTCTGACCCGTTCTGGGTGTCCTCCTCGCGCACCATCTTCAGCGACACGGCCATGCAGTTTGCGTCCC
GCCCGGACCGCAGTATCGAGACGTTCCTGAAGACCTGCCTCTCCATCGATCTGAAAAGTCTGCGTGAGTT
TCTGAAGAACACCCCGTCGGCCAACCTGGTTGAGGAGAAAATTGAGAAGACGGCCATCTCCATTCGCTCG
GTGCTCACCAACTACGCCAAGTCGCTGCGGTATCTGCAGGGGCTGGATAAGGAGGGCAAGCCGGAGTTCA
GCATCCGCGAGTGGATGACAGACGCGCAGTACGACAGCAGCTGGCTGTTTATCGCCACCACGGCCCGCCA
CCGCAAGGCGGTCCGGCCGCTGATTTCCATGTGGCTGTCGCTGGCCACGCTGCTGCTGCAGAGCATGGGC
GAGAACAGCGATCGCCGCGTGTGGTTCATCGGCGATGAGATAGCGAGTCTGCAGAAGATACCGGAGCTCA
ACGAAACGCTGGCCGAGGCGCGCAAGTTCGGCGGCTGCTTTGTGCTGGGTATCCAGAACATCCCGCAGCT
GGTGCATATCTACGGCCGGGAGATGGCCAAGGCCATCTTTGACCTGCTGAACACCCGCGCCTACGGCCGT
TCTCCGAGCGCCGAGGTGGCGAAAATGGTGGAGGAGGAACTGGGTCACCAGCGGCGGCGTGAGGCGCGCG
AGCAGAACAGCTACGGCCTGGATCAGGTCCGTGACGGTATCGCGATCAGCAAGGACAGGGTCAACGAACC
CATCGTGGACTACGACCTGATCATGAAAATGCCCAACCTGCGTTTTTACATACGCCTGCCGGGTGAGTAC
CCGGTGGTGAAACTGAGCCTGAAGTACCGCCCGCAGAAGAAGCATCACCCGGCGCTGATTGAGCGCGACT
TCCGTGATCGCCTGAGTCCGGAGCTCGAAGCCATCATTTCCGGCAACGAGCGGGCCGCCGTCGCTGCGGA
TATCCGCTTCCCGACCGGGGAGGAAATTCTGGAAGCCGGCAACGTGCAGTCAGTACAGAAAGTCCCTGAA
CCGGTGGCAGTCCCCGCCAGCCCCGTGACGGTCAGGAAGGTGACGGATACCACGCCGGTGCCGGGCGGGA
CAGACATCGCGCGGGACACCCGGCCTGTCATTATGCCTTTTTTACCGGAGGCGTCACTGCCGCCTTCGGT
ACGGGAAACGTCAGCGGGCAGGGGAGATCTTCCGACAAACGTCAGACCGTTCCCGGCCCGTCAGGGCATT
CCGGTCACTGCCCCAGATGTGACTGAGGCACTGCTCTCACAGGCGCGGTCCGCGGAAAGCCGCTCCGGGC
ATGACGCGACTGTCCCGTCACACACGCCGGCCCCTCTCCCGGAGGTGCGGCCGGCACCGAGTCCTGCAGC
ACCGGCACCTCCCGTTTCCCCGCAGTCACGCCCGGCACCGGCAGCCCTGAGCGCGCTGGACATGCTGGCC
CGCCGGACAAAAAAGCCGGCGGCCGCAGAGAGTGACGCTGACGCGTCCTCCGGTGACGCGCAGGGGGAGG
CCCCGGAACTGAACATGCAGGCGGAAAAGGATGAGGCCGGAAGGCTGACCGTGCGCAGCGCCGGGCACCG
TAAGACCGACCCTGAGAGCCGGGAAGAAGCGTATGCCGCGCAGTACGGCAGGGCAAATCAGCAGATGGCG
GATGAGGAGCTGAACATCCTGCGCCATCGCGAAGATGACGAAGCGTATCAGGCCATGAGCCAGCACCATG
AACCCGGAGGGCATGAGCGATGA
 Primer design