SecReT4
Protein ID: 317053481
T4SS name [ID]Tra_F [126]
Gene symbol-
Locus tagPat9b_4722
StrainPantoea sp. At-9b plasmid pPAT9B02 (NC_014839)
Repliconplasmid pPAT9B02 [GenBank: NC_014839] [Browse all T4SS(s) in this replicon]
Location [Strand]2674..8490 [+]
Productconjugative transfer relaxase protein TraI
Component typeTraI_F
UniProt IDE6WKX4
KEGG IDpao:Pat9b_4722
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 5.9e-75, Aligned region: 7..272
AAA_30 [PF13604], Evalue: 1.4e-45, Aligned region: 1064..1253
TraI [PF07057], Evalue: 2.1e-38, Aligned region: 1503..1620
AAA_19 [PF13245], Evalue: 1.1e-08, Aligned region: 1076..1140
UvrD_C_2 [PF13538], Evalue: 4.3e-05, Aligned region: 1418..1513
Protein Sequence: 1938 a.a.     [Download]
>gi|317053481|ref|YP_004118615.1| conjugative transfer relaxase protein TraI [Pantoea sp. At-9b]
MMTIAPVASAADAAGYYSSQDNYYFLDDLQSQWLGEGARELGLEGPVDLDTLTAVLHGKLPNGVELGKDV
QGSHVHRPGHDLTFSAPKSISMLILAGGDKRLLAAHHEAVKETLALVEQMVSARDTRDGVTRITATGKMV
AALFTHDTSRNLDPQIHTHAVLANVTELDGKWKALATDTIHGAGFIETLYRYQVSFGKLYRTALKGKTEA
LGYETELTGGKHELWEVKGFTGDVLEEFSSRHREISARVGEEASLKSRDVAALDTRRPKQDISRLDDGQP
VPQGEQPVTSPAGDNRSPDTVPPGRAVPPQTLSRSDAPEQGKPDAADGREVARTAEPENTLSEAPGTEPE
APQPGEHPPGRDSMNEQAGPDQESPIEKPETPDGRARLKARWQRQMDSVDFDIEGVMREARERVATREEP
GAETPLPGDVPEAVRTAISVLSDSRTRFTYGDLLLTAHQAGEQQHSIPDLRRALDRAISDNLLAPLDGDK
GVFTSHIHLLDELSVQSLAADIIKENRVVSFRGSPGMTPEHLKQAARAPVAILNAPASVQRLRDTVEELV
TMSRENGREVSVLASGAERALTLSKSALLKDTLLQRSRVTEKTFSLAPQSTLIIEGAEKLGLKEMLVLTG
EAREKNAQLLFLDSAGRQSNTNALSVLASAGVERLSLTAPAPGLEARVFSIQDKRDRYRALAERFTDLSV
PDSPVTAAVTGAREQQQLTGYIRDALQNAGKLGRDTVEVEARTPVFITAKERKLPVSYRPGMVLEDRSDR
QATRHFVIDRVHDDTRMLSLIDGDGVLSRVKLSALTADWRLFTREQLSIAQGEQLFALAADRSAGLKARD
RLTVTALEDGALTVMREGQQKALRIATDRPLYVTHGYVSAPGARDNERGTVLASLSSRELSANMMNALAQ
SGSEAEIFTGEALNRAEEKLMRLRTGRSPVALVRQASGREDVNDALETLNANLLTDAEKAVSRAVAQMRH
VSFSEVKLLEEAEDFLENVPALRTEIARQVKAGGLMPVMVGGESRFVSRATWEMEKAIVGEIAAGKNAVE
PLMATLAPSLLTGLTAGQQAATTLILQSPDRFTAVQGYAGTGKTTQFKAVRAAIETLPEGARPLIIGLAP
THRAVKEMRDTGIEAQTLKSFVLDWQQRTAAGEEVRYGNTLFLIDESSMLGNQDTAAAYRAIAAGDGRAV
QVGDVAQLESPESGAPFRLMQERSPIDVAVMKEIVRQRDANLKSAVYSVIENKAAAALEKINRVSPGTVP
REAGEVVPSRSVTETGSPVRNIVADYIGRTKEAREQTMIVVQLHEDRRAINEAIHIRMVQRKELGGNAVT
VPVLDRITGGRHDFNRIRDWKAGQVVLANERYLTVTGVDEGTDHVLLRDESGRMQYYSPAELNATEIEVF
ERREIELREGDSVRLNKTQKQAGHAAHEQYRVAALRDNGEIVLQNREGEKVIDPKAVTADRHVDYAWAVT
GYGAQGASTDYVIALEGTEGARANMSGMRAFYISASRAKAHVQIYTDGLKDWMGTLQGRESGPATAHDAL
SPEPERAQARSIWAMGQPLSKTAIGRAFLRGQGLKGAPLTARIIPPTKKYPDAHLALPVYDGNGKTAGLT
LVPLTAEAGQPQPGEVRQLITGGAQAAIVQKSRNGETVIVSDLQQALAAARDKPQAGVLLLTGRHPPSAQ
LLKVAGGQPGRGWRPDATLLRLVQAELQEGLRDLPPDAPVPDERAALRAALDALEKGQEVGQNVPSAPGR
DSAQENSRDLRAIGQLLTEGAIASLTTVPVVTERDRAQLSALLAMRVVEAMRQQLPFLPGEPVPDYAALV
RQASAALAAEAGGPDSVAVRAVLDTLSGVTLPQEPGISATAGQSDSIPAGVLKQVQEALARDRVQPGAPQ
QQALSESTLAGVARELERRPELPSDTRGREPEREELTRESVRHIQKER
 
Nucleotide Sequence: 5817 bp     [Download]
>gi|317053479|ref|NC_014839.1|:2674-8490 Pantoea sp. At-9b plasmid pPAT9B02, complete sequence
ATGATGACCATTGCACCGGTGGCGTCCGCGGCGGACGCGGCCGGGTACTACAGCAGCCAGGATAACTACT
ATTTCCTTGACGATCTGCAGAGCCAGTGGCTGGGCGAGGGGGCCCGCGAGCTGGGCCTGGAAGGACCGGT
GGACCTGGATACCTTAACCGCCGTACTGCACGGAAAGCTGCCAAACGGTGTGGAGCTGGGTAAAGACGTT
CAGGGCAGTCACGTTCACCGTCCCGGGCATGACCTGACGTTTTCGGCCCCGAAAAGCATCTCCATGCTCA
TTCTGGCCGGGGGGGATAAACGCCTGCTGGCCGCACATCATGAGGCGGTAAAGGAAACGCTGGCGCTGGT
TGAGCAGATGGTCAGCGCCCGTGACACACGGGACGGGGTGACCCGCATCACGGCGACCGGAAAAATGGTG
GCCGCCCTGTTCACGCACGACACCTCACGTAATCTTGACCCACAAATCCACACCCATGCGGTGCTGGCCA
ACGTGACAGAGCTGGACGGGAAGTGGAAGGCGCTGGCCACGGACACCATTCACGGTGCCGGGTTTATCGA
AACCCTTTACCGCTATCAGGTGTCATTCGGAAAGCTGTACCGCACCGCGCTGAAAGGTAAAACCGAGGCG
CTGGGGTATGAAACCGAACTCACCGGCGGAAAGCATGAGCTGTGGGAAGTGAAAGGTTTCACCGGTGACG
TCCTGGAGGAATTTTCCTCCCGGCACCGTGAAATCAGCGCACGCGTGGGGGAGGAGGCCTCGCTGAAAAG
CCGGGACGTGGCGGCACTTGACACCCGCCGCCCCAAACAGGATATCAGCCGGCTGGATGACGGCCAGCCG
GTCCCACAGGGTGAGCAGCCCGTGACTTCACCGGCAGGAGATAACCGGTCCCCGGATACCGTGCCGCCCG
GACGGGCTGTTCCGCCGCAGACGCTCAGCCGTTCCGATGCACCTGAGCAGGGCAAGCCAGACGCGGCTGA
CGGTCGCGAGGTTGCCCGCACTGCTGAGCCGGAGAACACGCTGTCAGAGGCGCCAGGCACCGAACCGGAA
GCCCCTCAGCCGGGAGAACATCCGCCCGGCCGCGACAGCATGAATGAACAGGCCGGGCCTGACCAGGAAT
CGCCCATTGAGAAACCGGAGACGCCGGACGGTCGTGCCCGCCTGAAAGCGCGCTGGCAGCGTCAGATGGA
CAGCGTGGATTTTGACATTGAGGGGGTGATGCGTGAAGCGCGCGAGCGTGTGGCGACGCGCGAGGAGCCC
GGAGCGGAGACGCCGCTGCCGGGTGACGTGCCGGAAGCGGTGCGCACCGCCATTTCGGTACTGAGCGACA
GCCGGACGCGCTTTACTTACGGCGACCTGCTGCTGACGGCCCACCAGGCCGGTGAACAGCAGCACAGTAT
CCCGGACCTGCGTCGCGCGCTGGACCGGGCCATCAGTGACAACCTGCTGGCCCCGCTGGACGGGGATAAA
GGCGTGTTCACCTCCCACATTCACCTGCTGGATGAACTGTCCGTGCAGTCGCTGGCGGCCGATATCATAA
AGGAGAACCGGGTGGTGAGCTTCCGTGGCTCCCCCGGCATGACGCCGGAACACCTGAAACAGGCGGCGCG
TGCGCCGGTGGCCATCCTGAACGCCCCGGCGTCGGTGCAGCGCCTGCGCGATACGGTGGAGGAACTGGTG
ACAATGTCACGGGAAAACGGCCGGGAAGTCAGCGTCCTGGCCTCCGGCGCCGAACGCGCACTCACCCTCA
GCAAATCGGCACTGCTGAAAGATACCCTGCTGCAGCGCAGCCGCGTCACTGAGAAAACCTTCAGTCTGGC
ACCCCAGAGCACGCTGATTATTGAGGGGGCAGAGAAGCTGGGGCTGAAGGAGATGCTGGTCCTGACCGGC
GAGGCGCGGGAGAAGAACGCCCAGCTGCTGTTTCTCGACAGCGCCGGCCGTCAGTCGAACACGAATGCCC
TGTCGGTGCTGGCCTCTGCCGGCGTTGAACGCCTGAGCCTGACGGCACCCGCACCGGGGCTGGAGGCGCG
CGTTTTCAGCATTCAGGACAAGCGTGACCGCTACCGTGCCCTGGCAGAACGCTTTACCGACCTGAGCGTC
CCGGACAGTCCGGTCACGGCGGCCGTGACCGGCGCGCGTGAACAGCAGCAGCTGACGGGGTACATCCGCG
ATGCGCTGCAGAATGCCGGGAAGCTCGGCCGGGACACTGTGGAGGTGGAGGCCCGCACGCCGGTCTTTAT
CACGGCGAAAGAGCGGAAGCTGCCGGTATCATACCGGCCCGGTATGGTGCTGGAAGATCGCAGCGACCGG
CAGGCCACCCGCCACTTTGTGATTGACCGGGTGCATGACGACACCCGCATGCTGTCGCTCATCGACGGCG
ACGGGGTGCTGAGCCGGGTAAAACTCAGCGCCCTCACCGCCGACTGGCGTCTGTTCACACGGGAACAGCT
GAGTATCGCACAGGGGGAGCAGCTGTTCGCGCTCGCCGCAGACCGGTCTGCCGGGCTGAAGGCGCGCGAC
CGCCTGACCGTCACGGCGCTGGAGGACGGGGCGCTGACGGTGATGCGGGAGGGGCAGCAGAAGGCGCTGC
GCATCGCCACGGACCGTCCCCTGTACGTCACCCACGGTTACGTCAGCGCACCGGGCGCACGGGATAACGA
ACGGGGCACGGTGCTGGCAAGCCTGAGCAGCCGGGAGCTGTCAGCCAACATGATGAACGCCCTGGCGCAG
TCCGGTTCAGAGGCCGAAATCTTTACCGGCGAGGCGCTGAACCGGGCGGAGGAGAAGCTGATGCGGCTGC
GCACCGGCCGTTCCCCGGTGGCGCTGGTCAGACAGGCCAGCGGCCGGGAGGACGTCAACGACGCGCTGGA
GACGCTGAATGCGAACCTGCTGACGGATGCGGAGAAGGCCGTATCCCGCGCCGTGGCGCAGATGCGGCAT
GTGTCCTTTTCCGAGGTAAAACTTCTGGAGGAAGCGGAGGATTTTCTGGAGAACGTGCCGGCGCTCAGGA
CCGAAATTGCCCGTCAGGTGAAAGCCGGCGGGCTCATGCCGGTGATGGTTGGCGGTGAATCGCGCTTTGT
CTCCCGCGCAACGTGGGAAATGGAAAAGGCGATAGTCGGGGAGATTGCGGCCGGCAAGAATGCGGTCGAG
CCGTTGATGGCCACCCTTGCCCCGTCCCTTCTCACCGGCCTCACCGCCGGACAGCAGGCCGCCACCACGC
TCATTCTGCAGAGTCCCGACCGCTTTACGGCAGTACAGGGGTATGCCGGTACCGGTAAAACCACGCAGTT
TAAGGCCGTCAGGGCGGCCATTGAGACCCTGCCGGAGGGCGCGCGACCGCTGATTATCGGGCTGGCCCCC
ACACACCGTGCGGTTAAAGAGATGCGCGATACCGGCATTGAGGCGCAGACGCTGAAATCGTTCGTGCTGG
ACTGGCAGCAGCGCACCGCCGCCGGTGAAGAGGTCCGCTACGGCAATACCCTGTTTCTCATCGATGAGTC
CTCGATGCTGGGTAACCAGGACACGGCCGCGGCGTACCGTGCGATTGCGGCCGGTGACGGGCGCGCCGTG
CAGGTCGGGGATGTGGCGCAGCTGGAGTCCCCGGAGAGTGGCGCCCCGTTCCGGCTGATGCAGGAGCGCA
GCCCGATTGATGTCGCCGTGATGAAAGAGATTGTGCGCCAGCGCGACGCAAACCTGAAATCTGCCGTCTA
CAGCGTGATTGAAAACAAGGCGGCCGCGGCCCTGGAGAAAATCAACCGGGTGTCACCGGGGACGGTGCCG
CGGGAAGCCGGTGAGGTGGTCCCGTCGCGCTCGGTGACGGAGACGGGCTCACCGGTCAGAAACATCGTGG
CGGATTACATCGGCCGCACGAAAGAAGCCCGGGAGCAGACGATGATCGTGGTGCAGCTTCATGAGGACCG
TCGCGCCATCAATGAGGCTATCCACATCAGGATGGTACAGCGAAAAGAACTGGGCGGGAATGCCGTCACG
GTGCCGGTACTGGACCGCATCACCGGCGGTCGCCACGACTTTAACCGCATCAGGGACTGGAAGGCCGGTC
AGGTGGTGCTGGCGAATGAACGCTACCTGACCGTGACCGGGGTGGATGAGGGAACGGACCATGTGCTGCT
GCGCGATGAAAGCGGGCGGATGCAGTATTACTCGCCGGCGGAGCTTAACGCCACCGAAATCGAGGTGTTT
GAGCGGCGTGAAATCGAGCTGAGGGAGGGCGACAGCGTGCGCCTGAACAAGACGCAGAAGCAGGCCGGTC
ACGCCGCGCACGAGCAGTACCGTGTGGCGGCGCTGCGGGATAACGGTGAGATTGTGCTGCAGAACCGGGA
GGGTGAAAAGGTCATCGACCCGAAGGCCGTCACGGCGGACCGGCATGTGGACTATGCCTGGGCGGTTACC
GGCTACGGTGCCCAGGGGGCGAGTACGGACTACGTGATTGCGCTGGAAGGGACGGAGGGGGCCCGCGCGA
ACATGAGCGGGATGCGGGCCTTTTACATCAGCGCCTCACGTGCGAAGGCGCATGTGCAGATTTACACCGA
CGGTCTGAAAGACTGGATGGGCACCCTGCAGGGCAGGGAGAGCGGTCCGGCAACCGCGCACGATGCCCTG
TCACCGGAGCCGGAGCGGGCACAGGCCCGGTCCATCTGGGCGATGGGGCAGCCGCTGTCGAAAACGGCGA
TCGGGCGCGCCTTCCTGCGCGGGCAGGGGCTGAAGGGGGCACCGCTCACCGCCCGGATTATCCCGCCGAC
GAAGAAATACCCGGACGCGCACCTGGCGCTGCCGGTGTATGACGGCAACGGCAAGACGGCGGGGCTGACG
CTGGTTCCGCTGACGGCGGAGGCCGGTCAGCCACAGCCGGGTGAGGTGCGTCAGCTTATCACCGGTGGGG
CACAGGCTGCCATTGTGCAGAAAAGCCGGAACGGAGAGACGGTCATCGTCAGTGACCTGCAGCAGGCGCT
GGCAGCCGCACGGGATAAGCCGCAGGCGGGCGTGCTGCTGCTGACCGGGCGTCATCCGCCGTCGGCCCAG
TTACTGAAAGTGGCCGGTGGCCAGCCCGGACGGGGCTGGCGTCCTGATGCCACACTGCTGCGTCTGGTAC
AGGCTGAGCTTCAGGAGGGGCTGCGCGACCTGCCGCCGGATGCACCAGTGCCCGATGAGCGTGCCGCACT
GCGTGCAGCCCTGGACGCACTGGAAAAAGGCCAGGAAGTCGGTCAGAACGTTCCGTCCGCGCCAGGACGG
GACAGTGCTCAGGAGAACAGCCGTGACTTGCGTGCCATTGGACAGCTGCTGACAGAGGGCGCGATAGCCA
GCCTGACCACCGTCCCGGTGGTGACGGAACGGGACAGGGCACAGCTGTCTGCGTTGCTGGCCATGCGGGT
GGTGGAGGCCATGAGGCAGCAACTGCCGTTCCTGCCCGGCGAACCCGTACCTGACTATGCCGCCCTGGTC
AGACAGGCTTCAGCTGCACTGGCGGCCGAAGCCGGCGGCCCGGACAGTGTAGCTGTCCGCGCCGTGCTGG
ACACACTGTCCGGGGTCACGCTGCCGCAGGAGCCGGGAATTTCTGCCACTGCTGGCCAGAGTGACAGCAT
ACCGGCAGGGGTACTGAAGCAAGTACAGGAGGCGCTTGCACGCGATCGGGTACAGCCGGGGGCACCCCAA
CAGCAGGCGCTGTCAGAAAGTACACTTGCCGGCGTGGCCCGTGAGCTTGAACGGCGGCCGGAGCTGCCGT
CAGACACACGGGGCCGGGAGCCGGAACGTGAAGAGCTGACACGCGAGAGCGTCCGGCATATCCAGAAAGA
ACGCTGA
 Primer design