SecReT4
Protein ID: 317053679
T4SS name [ID]Tra_F [126]
Gene symbol-
Locus tagPat9b_4957
StrainPantoea sp. At-9b plasmid pPAT9B02 (NC_014839)
Repliconplasmid pPAT9B02 [GenBank: NC_014839] [Browse all T4SS(s) in this replicon]
Location [Strand]228257..229033 [+]
ProductTraX family protein
Component typeTraX_F
UniProt IDE6WLH2
KEGG IDpao:Pat9b_4957
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 5.7e-37, Aligned region: 24..252
Protein Sequence: 258 a.a.     [Download]
>gi|317053679|ref|YP_004118813.1| TraX family protein [Pantoea sp. At-9b]
MHALLTSLRLSSPFHQIKSLSPFQADIIKTIALLAMLADHINTILLNGHNALLSAVGHSAFPLFTLIWAI
NLPEDSARLRQRAKRLWLWALATQPLFWLAFMMKGQSWLALNILFAYAGCTQLLSWSARWGVNGAMAGLA
VLLLLAWPLTPASYGIPGIVFCLLCMAARCISAVAESRLFLMLVFVAMAWLSLPGNGYDDTLVYDLLPGL
VLPLLIITAVAALPHISATRLWPRRFFYHAYAGHLTLLGVLAVMPVRL
 
Nucleotide Sequence: 777 bp     [Download]
>gi|317053479|ref|NC_014839.1|:228257-229033 Pantoea sp. At-9b plasmid pPAT9B02, complete sequence
ATGCACGCGCTGCTAACTTCGCTACGTTTGTCTTCACCTTTTCATCAGATTAAATCATTAAGCCCTTTTC
AGGCCGATATCATTAAAACCATTGCCCTGCTGGCGATGTTAGCGGATCACATTAACACCATTCTATTAAA
TGGCCACAATGCCTTGCTTTCCGCCGTTGGTCATTCTGCGTTTCCTTTATTTACCCTTATCTGGGCCATC
AACCTGCCTGAAGATAGCGCACGGTTACGTCAGCGCGCCAAACGGCTCTGGCTCTGGGCACTTGCCACCC
AGCCGCTATTCTGGCTGGCTTTTATGATGAAAGGACAATCCTGGCTGGCGCTGAACATTCTGTTCGCCTA
TGCCGGTTGCACGCAATTGCTGAGTTGGTCTGCACGCTGGGGCGTCAATGGCGCGATGGCAGGGCTGGCG
GTACTTTTGTTGCTGGCATGGCCGTTAACGCCCGCCAGCTACGGCATTCCCGGTATTGTGTTTTGCCTGC
TGTGCATGGCCGCCCGCTGCATCAGTGCCGTGGCGGAAAGTCGGTTGTTTCTGATGCTGGTGTTTGTCGC
GATGGCGTGGCTGAGCCTGCCCGGTAACGGTTATGACGATACCCTGGTTTATGATCTGCTGCCGGGACTG
GTGCTGCCGCTGCTGATCATCACGGCAGTCGCTGCGCTGCCGCATATCTCCGCGACACGGCTCTGGCCAA
GGCGCTTTTTCTATCATGCTTACGCCGGGCATCTCACCCTGCTTGGCGTTCTGGCGGTGATGCCGGTACG
GCTTTAA
 Primer design