SecReT4
Protein ID: 317053785
T4SS name [ID]Tra_F [126]
Gene symbol-
Locus tagPat9b_5095
StrainPantoea sp. At-9b plasmid pPAT9B02 (NC_014839)
Repliconplasmid pPAT9B02 [GenBank: NC_014839] [Browse all T4SS(s) in this replicon]
Location [Strand]366626..367159 [-]
ProductLytic transglycosylase catalytic
Component typeOrf169_F
UniProt IDE6WLS8
KEGG IDpao:Pat9b_5095
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 177 a.a.     [Download]
>gi|317053785|ref|YP_004118919.1| Lytic transglycosylase catalytic [Pantoea sp. At-9b]
MKWFACAGFAAIFSVQAAPEMCFTKAGEGFGIDPRLLMAHSIQESRMRNNALNTRSSGGTHDVCNMQINS
SHFDQLKKFDITRERLLKDPCICIYTGAWIEARNFRQYGRNWDSVGMYNTGPSPKLIKQRREYAAIIKSI
YRVLIARDEVYAAMTQQNKKTPAPETFLSADVDTRIK
 
Nucleotide Sequence: 534 bp     [Download]
>gi|317053479|ref|NC_014839.1|:c367159-366626 Pantoea sp. At-9b plasmid pPAT9B02, complete sequence
ATGAAATGGTTCGCCTGTGCAGGCTTTGCCGCAATATTCAGCGTGCAGGCTGCACCAGAAATGTGTTTCA
CAAAGGCCGGGGAAGGTTTCGGTATTGATCCGCGCCTGCTGATGGCACACTCCATTCAGGAATCGCGCAT
GCGTAATAATGCGCTGAATACCAGAAGCAGCGGGGGAACGCATGACGTCTGCAACATGCAGATCAACAGC
TCTCATTTTGATCAGCTGAAAAAGTTTGATATTACGCGGGAAAGGCTTCTGAAAGATCCGTGTATCTGCA
TTTATACCGGCGCGTGGATCGAGGCGCGCAATTTCAGGCAGTACGGCAGGAACTGGGACAGCGTCGGGAT
GTATAACACCGGCCCCAGCCCGAAGCTCATAAAACAGCGCCGTGAGTATGCGGCAATAATTAAAAGTATC
TATCGCGTGCTTATCGCCCGTGATGAGGTTTATGCTGCCATGACACAGCAGAATAAAAAAACGCCTGCGC
CGGAAACTTTTCTCAGCGCAGACGTTGACACCCGCATAAAATAA
 Primer design