SecReT4
Protein ID: 317053788
T4SS name [ID]Tra_F [126]
Gene symbol-
Locus tagPat9b_5098
StrainPantoea sp. At-9b plasmid pPAT9B02 (NC_014839)
Repliconplasmid pPAT9B02 [GenBank: NC_014839] [Browse all T4SS(s) in this replicon]
Location [Strand]369671..370063 [+]
ProductTraA family protein
Component typeTraA_F
UniProt IDE6WLT1
KEGG IDpao:Pat9b_5098
PDB IDNA
Domain hit(s) vs Pfam TraA [PF05513], Evalue: 2.5e-11, Aligned region: 38..125
Protein Sequence: 130 a.a.     [Download]
>gi|317053788|ref|YP_004118922.1| TraA family protein [Pantoea sp. At-9b]
MKVISGNPALAEGAAEACPSRRARVPSGIIGIVLRAFSVIRRHRVNVLLIALAVLCFALPHLVRAEDLLS
SQKQDAKDTFGHGSTIEWGLYIAEVIISIGAYIKTRNPMLFVGGLGFLIVVTRVLFSLAG
 
Nucleotide Sequence: 393 bp     [Download]
>gi|317053479|ref|NC_014839.1|:369671-370063 Pantoea sp. At-9b plasmid pPAT9B02, complete sequence
ATGAAAGTTATCTCAGGCAATCCCGCGCTGGCGGAGGGGGCTGCGGAAGCCTGCCCGTCGCGCCGGGCCA
GAGTGCCATCAGGCATTATCGGCATCGTTCTGCGCGCCTTTAGCGTTATCCGCCGCCACCGCGTTAACGT
GCTGCTGATTGCCCTGGCAGTGCTGTGCTTCGCGCTCCCGCATCTGGTGCGCGCCGAAGACCTGCTCTCC
AGCCAGAAGCAGGATGCGAAGGATACGTTCGGCCACGGCAGTACCATCGAGTGGGGGCTGTACATTGCCG
AAGTCATCATCTCCATCGGCGCCTACATCAAAACCCGCAACCCGATGCTGTTCGTGGGCGGCCTCGGCTT
CCTTATTGTCGTCACCCGCGTTCTCTTCAGCCTCGCCGGTTAA
 Primer design