SecReT4
Protein ID: 317053789
T4SS name [ID]Tra_F [126]
Gene symbol-
Locus tagPat9b_5099
StrainPantoea sp. At-9b plasmid pPAT9B02 (NC_014839)
Repliconplasmid pPAT9B02 [GenBank: NC_014839] [Browse all T4SS(s) in this replicon]
Location [Strand]370072..370374 [+]
Producttype IV conjugative transfer system protein TraL
Component typeTraL_F
UniProt IDE6WLT2
KEGG IDpao:Pat9b_5099
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 1.6e-30, Aligned region: 7..99
Protein Sequence: 100 a.a.     [Download]
>gi|317053789|ref|YP_004118923.1| type IV conjugative transfer system protein TraL [Pantoea sp. At-9b]
MDRESLQYQFPETLNQQKRILGLPTEEAVVIVACAGIGLLCDMFIVMLVVAGALWLLIRHLKKGQGTWWL
LNLLYWYLPTALLRLQFRRVPDSGNRHWMQ
 
Nucleotide Sequence: 303 bp     [Download]
>gi|317053479|ref|NC_014839.1|:370072-370374 Pantoea sp. At-9b plasmid pPAT9B02, complete sequence
ATGGACAGGGAATCGCTTCAGTACCAGTTCCCGGAAACCCTCAATCAGCAGAAACGTATTCTCGGACTCC
CGACAGAAGAGGCCGTGGTCATCGTTGCGTGCGCCGGTATCGGCCTGCTCTGCGACATGTTCATCGTGAT
GCTGGTTGTGGCCGGCGCGTTGTGGCTGTTAATCCGCCATCTGAAGAAGGGGCAGGGCACCTGGTGGCTC
CTGAATCTCCTTTACTGGTATCTGCCGACCGCGCTGCTCCGGCTGCAGTTCAGGCGGGTGCCCGACTCGG
GCAACCGGCACTGGATGCAGTAA
 Primer design