SecReT4
Protein ID: 317053790
T4SS name [ID]Tra_F [126]
Gene symbol-
Locus tagPat9b_5100
StrainPantoea sp. At-9b plasmid pPAT9B02 (NC_014839)
Repliconplasmid pPAT9B02 [GenBank: NC_014839] [Browse all T4SS(s) in this replicon]
Location [Strand]370426..371025 [+]
Producttype IV conjugative transfer system protein TraE
Component typeTraE_F
UniProt IDE6WLT3
KEGG IDpao:Pat9b_5100
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 4.4e-35, Aligned region: 1..188
Protein Sequence: 199 a.a.     [Download]
>gi|317053790|ref|YP_004118924.1| type IV conjugative transfer system protein TraE [Pantoea sp. At-9b]
MKYKVREGRNRVTVLALAGLGSLLALSIAANGITGALAWHFARTQKTITVPMLFDRPFVSTAASGDDALN
GLLVRSFINLRLSVTPETVDSQHAALLRFVPPEDRDAMKKQLAAEAEYIKKYGVSSVFRLDDETTDTITG
DITVRGTLSAGTSSGNLKLSLPDANKAWRLSVHYVDGLIRLTAFTEVPWTQPDRRPQQD
 
Nucleotide Sequence: 600 bp     [Download]
>gi|317053479|ref|NC_014839.1|:370426-371025 Pantoea sp. At-9b plasmid pPAT9B02, complete sequence
ATGAAGTACAAGGTCCGGGAGGGGCGCAATCGTGTAACGGTGCTGGCGCTGGCGGGGCTGGGTTCGCTTC
TGGCCCTGAGCATTGCCGCGAACGGCATCACCGGCGCCCTCGCATGGCACTTTGCCCGCACCCAGAAAAC
CATCACCGTTCCCATGCTGTTTGACCGGCCGTTTGTCTCCACCGCCGCCTCCGGAGACGACGCCCTGAAC
GGACTGCTGGTCCGTTCGTTTATCAATCTTCGCCTGTCCGTCACGCCCGAGACCGTGGACAGCCAGCACG
CCGCCCTGCTGCGCTTTGTTCCGCCGGAAGACCGTGACGCCATGAAAAAACAGCTGGCCGCCGAAGCTGA
ATACATCAAAAAGTACGGCGTCTCCTCCGTGTTCCGCCTTGACGATGAAACCACCGACACCATCACCGGT
GATATCACCGTCAGGGGCACGCTGAGCGCCGGCACCTCCAGCGGCAACCTGAAACTTTCGCTGCCTGACG
CTAACAAAGCCTGGCGACTCAGCGTGCACTACGTGGACGGCCTTATCCGCCTGACGGCTTTCACGGAAGT
GCCCTGGACGCAACCTGACCGCCGCCCGCAACAGGACTGA
 Primer design