SecReT4
Protein ID: 317053791
T4SS name [ID]Tra_F [126]
Gene symbol-
Locus tagPat9b_5101
StrainPantoea sp. At-9b plasmid pPAT9B02 (NC_014839)
Repliconplasmid pPAT9B02 [GenBank: NC_014839] [Browse all T4SS(s) in this replicon]
Location [Strand]371029..371766 [+]
Producttype-F conjugative transfer system secretin TraK
Component typeTraK_F
UniProt IDE6WLT4
KEGG IDpao:Pat9b_5101
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 1.1e-46, Aligned region: 13..235
Protein Sequence: 245 a.a.     [Download]
>gi|317053791|ref|YP_004118925.1| type-F conjugative transfer system secretin TraK [Pantoea sp. At-9b]
MKKTVFVLTAVASLTLLPAVASAVVPGPAGTVFENNAHLKAQMSNTSPNKIVIDGELITAVTGPEGAYTR
DSTADGALLITPLTGQDFTLFIETAGGVSVSLDVSPKPGSGRTLELIPSDVPLKPNPDAKVWEESQPFPK
TLVSVARTVANGGVPDGYTDVKASRAPAYNPPADVLLSPERQLAGSHLRVVRYRMKNTGYVTRALSEKQF
WQQGVRAVMLSTRTLYANGEGYVWVIFSTDKEGGA
 
Nucleotide Sequence: 738 bp     [Download]
>gi|317053479|ref|NC_014839.1|:371029-371766 Pantoea sp. At-9b plasmid pPAT9B02, complete sequence
ATGAAGAAAACCGTTTTCGTGCTCACCGCCGTGGCGTCGCTTACGCTGTTGCCCGCCGTGGCCTCAGCCG
TGGTGCCCGGCCCGGCCGGCACCGTATTTGAAAATAACGCGCACCTGAAGGCGCAGATGAGCAACACCAG
CCCGAACAAAATTGTCATCGACGGCGAACTGATTACCGCCGTCACCGGCCCGGAGGGCGCGTACACCCGG
GACAGCACCGCCGACGGCGCGCTGCTCATCACGCCGCTGACCGGGCAGGATTTCACCCTCTTTATCGAAA
CGGCCGGCGGGGTGAGCGTCTCGCTCGATGTGTCACCGAAACCCGGCAGCGGCCGCACGCTGGAGCTTAT
CCCTTCGGACGTGCCGCTGAAGCCGAACCCGGACGCGAAGGTGTGGGAAGAGAGCCAGCCGTTCCCGAAA
ACGCTGGTCAGCGTGGCGCGCACCGTGGCAAACGGCGGCGTGCCTGACGGCTATACCGACGTAAAGGCCA
GCCGGGCTCCGGCGTACAACCCGCCCGCCGACGTCCTGCTCTCGCCGGAACGTCAGCTGGCAGGCTCACA
CCTGCGGGTGGTGCGTTACCGGATGAAAAACACCGGTTATGTCACCCGCGCCCTCAGTGAAAAGCAGTTC
TGGCAGCAGGGCGTGCGCGCGGTGATGCTCTCCACCCGCACCCTGTATGCGAACGGGGAAGGGTACGTGT
GGGTGATTTTCTCCACGGATAAGGAGGGCGGGGCATGA
 Primer design