SecReT4
Protein ID: 317053792
T4SS name [ID]Tra_F [126]
Gene symbol-
Locus tagPat9b_5102
StrainPantoea sp. At-9b plasmid pPAT9B02 (NC_014839)
Repliconplasmid pPAT9B02 [GenBank: NC_014839] [Browse all T4SS(s) in this replicon]
Location [Strand]371763..373130 [+]
ProductTraB pilus assembly family protein
Component typeTraB_F
UniProt IDE6WLT5
KEGG IDpao:Pat9b_5102
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.6e-41, Aligned region: 200..397
Protein Sequence: 455 a.a.     [Download]
>gi|317053792|ref|YP_004118926.1| TraB pilus assembly family protein [Pantoea sp. At-9b]
MSSINTLTRRRQWMIAGAAAAVMLATGGGIWAYSRHQAELNHPAQKSAPDMTGSLVNTSFTSGVATSALQ
QQQNKTAGLEKDLASLTGTLKAQNEDLQKKLGTMADAITQLQKQQMQEGSKPPAGPGQGSTPPSGPAANA
PVSTGPAGPAQWRVGDPSGGPSAGQGSRFYPGTGTVRAGGLQRDTFTYASLAAKKTNLPWIPSGSFSEAV
MIEGADANASVTGQQNTSPVVITLIGDVSMPNGKTYSLDQCRVTGEIYGDISSERGEVRTKNISCILKNG
KHIDMPFDGHVAYQGKQGIRGKPVMRNGAIIANAGAAGLLSGFGEGIKSAATPTVGLGASASVGAGDILK
QGFGGGASKAADTLSQYWIKRAEQYHPVIDIGAGNAVTVVFQQGFRLATIEDADAEKEKKAAPQAGTQQT
AAVTPANSGGGNAPVLNPDEVLRQASQLRLGDTIN
 
Nucleotide Sequence: 1368 bp     [Download]
>gi|317053479|ref|NC_014839.1|:371763-373130 Pantoea sp. At-9b plasmid pPAT9B02, complete sequence
ATGAGCAGCATCAATACCCTGACCCGCCGCCGGCAGTGGATGATTGCCGGCGCGGCCGCGGCGGTGATGC
TCGCCACCGGCGGCGGCATCTGGGCGTATTCACGCCATCAGGCTGAGCTGAACCATCCGGCACAGAAATC
CGCGCCGGATATGACCGGCAGCCTGGTGAACACGTCCTTCACCAGCGGCGTGGCTACCTCGGCGCTGCAG
CAGCAGCAGAACAAAACCGCCGGGCTGGAAAAGGACCTCGCGTCGCTCACCGGCACGCTGAAGGCGCAGA
ATGAGGACCTGCAGAAGAAGCTGGGCACGATGGCGGATGCCATCACTCAGCTGCAGAAGCAGCAGATGCA
GGAGGGCAGCAAACCGCCTGCCGGGCCGGGACAGGGCAGCACACCGCCGTCCGGTCCTGCTGCGAATGCC
CCGGTCTCCACCGGCCCGGCGGGACCGGCACAGTGGCGAGTGGGGGATCCGTCAGGCGGGCCTTCTGCCG
GTCAGGGAAGCCGGTTTTACCCCGGCACCGGCACGGTACGCGCCGGTGGCCTTCAGCGTGACACCTTCAC
GTATGCCTCGCTCGCGGCGAAAAAAACGAACCTGCCGTGGATACCGTCGGGGTCGTTCTCTGAGGCGGTC
ATGATTGAGGGGGCAGACGCCAACGCCAGCGTGACCGGTCAGCAGAACACCTCGCCCGTGGTCATCACCC
TTATCGGGGATGTCTCGATGCCCAACGGTAAAACGTACAGCCTCGACCAGTGCCGCGTCACCGGGGAAAT
TTACGGTGATATCTCCAGCGAGCGCGGCGAAGTCCGCACGAAAAACATCAGCTGCATCCTGAAAAACGGT
AAACACATCGATATGCCGTTTGACGGGCATGTGGCTTACCAGGGCAAGCAGGGTATCCGCGGCAAGCCGG
TCATGCGCAACGGTGCCATCATCGCCAACGCCGGCGCAGCCGGCCTGCTTTCCGGCTTCGGGGAGGGGAT
CAAATCTGCCGCCACGCCGACCGTGGGTCTGGGGGCCTCGGCGTCTGTGGGCGCGGGCGATATCCTGAAG
CAGGGATTTGGTGGCGGGGCCAGCAAGGCCGCCGACACGCTGAGTCAGTACTGGATCAAACGTGCTGAGC
AGTACCACCCGGTGATTGATATCGGGGCCGGTAACGCCGTCACCGTGGTCTTCCAGCAGGGATTCCGGCT
GGCGACCATCGAGGATGCGGACGCGGAGAAAGAGAAGAAAGCCGCACCACAGGCCGGCACGCAGCAGACT
GCTGCGGTTACGCCGGCAAACAGCGGTGGCGGCAACGCCCCGGTACTGAACCCCGACGAAGTGCTGCGTC
AGGCCAGTCAGCTTCGCCTCGGTGACACCATCAACTGA
 Primer design