SecReT4
Protein ID: 317053798
T4SS name [ID]Tra_F [126]
Gene symbol-
Locus tagPat9b_5108
StrainPantoea sp. At-9b plasmid pPAT9B02 (NC_014839)
Repliconplasmid pPAT9B02 [GenBank: NC_014839] [Browse all T4SS(s) in this replicon]
Location [Strand]375165..375713 [+]
Producttype IV conjugative transfer system protein TraV
Component typeTraV_F
UniProt IDE6WLU1
KEGG IDpao:Pat9b_5108
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 8.6e-23, Aligned region: 21..171
Protein Sequence: 182 a.a.     [Download]
>gi|317053798|ref|YP_004118932.1| type IV conjugative transfer system protein TraV [Pantoea sp. At-9b]
MHKLFACALLCAALTGCAGMNSDFDCNKTATDQCLSMSDASHLASKHQSLDDLSAAKDSGPKPAAEALAT
PGNLKPAVNPNRTVSVATVAPRAVAGQPVSPALLRASTVPVRTGAVGAGSITPADYSGPGQVDARRIPDA
TQRLWIAPWVDEQDSFHQPAVVEFVKQKSRWDEDFRVISEGE
 
Nucleotide Sequence: 549 bp     [Download]
>gi|317053479|ref|NC_014839.1|:375165-375713 Pantoea sp. At-9b plasmid pPAT9B02, complete sequence
ATGCATAAACTCTTTGCGTGCGCACTGCTGTGCGCGGCGCTCACCGGCTGTGCCGGTATGAACTCCGACT
TTGACTGTAACAAAACCGCCACCGACCAGTGTCTCTCAATGTCGGATGCCAGCCACCTGGCTTCGAAACA
CCAGAGTCTGGACGACCTGAGTGCTGCAAAGGACAGCGGCCCAAAGCCTGCGGCTGAGGCGCTGGCGACG
CCCGGCAACCTGAAGCCTGCCGTTAACCCGAACCGCACCGTCAGTGTGGCCACGGTCGCGCCCCGCGCCG
TGGCGGGACAGCCCGTCAGTCCCGCACTGCTCCGGGCTTCCACGGTGCCGGTGCGCACAGGTGCAGTGGG
GGCCGGCAGCATTACCCCGGCGGATTACAGCGGACCCGGCCAGGTGGATGCCCGGCGTATCCCGGATGCC
ACACAGCGCCTGTGGATAGCACCCTGGGTGGATGAACAGGACAGCTTCCATCAGCCCGCCGTGGTGGAGT
TTGTGAAGCAGAAATCCCGCTGGGACGAAGATTTTCGCGTGATCAGCGAGGGGGAATAA
 Primer design