SecReT4
Protein ID: 317053800
T4SS name [ID]Tra_F [126]
Gene symbol-
Locus tagPat9b_5110
StrainPantoea sp. At-9b plasmid pPAT9B02 (NC_014839)
Repliconplasmid pPAT9B02 [GenBank: NC_014839] [Browse all T4SS(s) in this replicon]
Location [Strand]375981..378620 [+]
Producttype-IV secretion system protein TraC
Component typeTraC_F
UniProt IDE6WLU3
KEGG IDpao:Pat9b_5110
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 5.9e-50, Aligned region: 35..280
AAA_10 [PF12846], Evalue: 7.5e-41, Aligned region: 483..777
Protein Sequence: 879 a.a.     [Download]
>gi|317053800|ref|YP_004118934.1| type-IV secretion system protein TraC [Pantoea sp. At-9b]
MLSNVIDHLAGILSSSREEGGAKSARQKLEENFSYPSLTSLLPYREYDEKSDLFINSRSVGFIMEVAPLA
GANHQVVQALDDLLRKKLPRKTPVTVLMVASKCVGDMLENGLSRDMWKGSMAPRLNAITKAYWERSALKG
LVNNREYPLYLRNYRVFLVYAHPGTGGLRVMDEVAQIRETLRVSMQAAHMDTLRVTPPEFLTLIREQINY
RPGQVNAGAGHWNQEQELHRQCVDHSTEMEVHPGYLRLTTARQPGDRRVGREDAIASARIVNMQLTKEPK
QFALWQMSDNLQNMRFPDLGIPCPFLLSWTICVEDQVTSQNEAFRKEQDMGKKANSSYGKLFPNTQLAYQ
QWRDLRMGLASNEIAMCSFNLNLTLFTPDSDSGQQACELAAINVFRKNDLEMSAPRYQQLRNWLTTFPFL
MQEGLWDDMKHMNATLRCKSFNAVNLMPVVAERQMSPQGIPLATYRNQIAFFDMFDEDNGSTNFNIGVTG
TSGAGKSFLIQGILREVLNAQGFAWVIDMGGSYRNYCRQAGGAYLDGETLRFNPFANVTDIAESAEGITG
LLTVLASPQGSLDEVSEAILQKGVVAAWEARRNKARIDDVVLYMKCDVVREEYGQQPTIMSRINELVLLL
DRWCTWGSDGEYFNSDKPTLDGETRFTVLELLGLEKRPHLLSAVLYSLILAIQEKMYHSPRDLKKVAIID
EAWRLFSGQNPHAARFIETGYRTVRRHRGAFVTITQGIKDFTGLPDRPAPSAAAAAWDNSGTKITLLQEA
KAFKTYLKEWPEQFSEMETQIIRGFAKASLTGFSSVMISMGEQSSFYRVFVDPVTRAMFSTTGEDYQYMT
EAQRAGATSEESAYLLACEPHMYQAEMQELERWAGITTA
 
Nucleotide Sequence: 2640 bp     [Download]
>gi|317053479|ref|NC_014839.1|:375981-378620 Pantoea sp. At-9b plasmid pPAT9B02, complete sequence
ATGCTCAGTAACGTTATCGATCATCTGGCCGGCATACTCAGCAGCAGCCGCGAAGAAGGGGGCGCAAAGT
CGGCCCGGCAGAAGCTGGAGGAGAACTTCAGCTATCCCTCCCTCACCAGCCTGCTGCCTTATCGCGAGTA
CGATGAAAAATCCGACCTGTTTATCAACAGCCGGTCGGTCGGTTTCATCATGGAGGTGGCACCGCTCGCC
GGGGCCAATCATCAGGTGGTGCAGGCGCTGGATGACCTGCTGCGTAAAAAGCTGCCGCGTAAAACGCCGG
TCACGGTGCTGATGGTTGCCAGCAAGTGCGTGGGCGACATGCTGGAAAACGGGCTGAGCCGCGACATGTG
GAAAGGCAGCATGGCACCGCGCCTCAACGCCATCACCAAAGCCTACTGGGAACGCTCGGCGCTGAAGGGG
CTCGTCAATAACCGGGAATACCCGCTCTATCTGCGGAATTACCGCGTGTTTCTGGTGTACGCCCACCCTG
GCACCGGGGGGCTGCGGGTGATGGATGAGGTGGCCCAGATACGTGAAACCCTGCGCGTCTCGATGCAGGC
TGCCCATATGGATACCCTGCGGGTGACACCGCCGGAGTTCCTGACCCTCATCCGCGAGCAGATCAACTAC
CGTCCGGGGCAGGTGAATGCCGGTGCAGGGCACTGGAATCAGGAGCAGGAGCTGCACCGGCAGTGCGTGG
ATCACAGTACCGAAATGGAAGTGCATCCGGGCTACCTGCGTCTCACCACGGCGCGGCAGCCCGGTGACCG
ACGTGTGGGAAGGGAGGATGCCATTGCCAGCGCGCGCATCGTCAATATGCAGCTGACGAAGGAGCCGAAG
CAGTTCGCGCTCTGGCAGATGTCGGACAACCTGCAGAACATGCGCTTTCCGGACCTCGGTATTCCCTGTC
CGTTCCTGCTGAGCTGGACCATCTGCGTTGAAGATCAGGTCACCAGCCAGAACGAGGCGTTCCGTAAGGA
ACAGGACATGGGCAAAAAGGCCAACTCCTCCTACGGCAAACTGTTCCCGAACACGCAGCTTGCTTATCAG
CAATGGCGTGACCTGCGCATGGGGCTGGCCAGCAACGAAATCGCCATGTGCAGCTTCAACCTTAACCTGA
CGCTGTTCACGCCCGACAGCGACAGCGGGCAGCAGGCCTGCGAACTCGCAGCCATCAACGTGTTCCGTAA
AAATGACCTGGAGATGTCCGCCCCGCGTTATCAGCAGCTGCGCAACTGGCTCACCACCTTCCCGTTTCTG
ATGCAGGAGGGGCTGTGGGACGACATGAAGCACATGAATGCCACCCTGCGCTGCAAGAGCTTTAACGCGG
TGAACCTGATGCCGGTGGTCGCCGAGCGGCAGATGTCGCCGCAGGGCATACCGCTGGCGACCTACCGCAA
CCAGATTGCCTTTTTTGACATGTTCGATGAGGACAACGGCTCGACCAACTTCAACATTGGCGTGACAGGG
ACGTCCGGCGCAGGCAAGAGCTTCCTGATACAGGGCATCCTGCGTGAGGTCCTTAACGCACAGGGATTTG
CCTGGGTTATCGACATGGGGGGCAGCTACCGGAACTACTGCCGGCAGGCGGGCGGGGCCTATCTTGACGG
CGAAACGCTGCGCTTTAACCCGTTTGCAAACGTCACGGACATTGCTGAATCGGCGGAAGGTATCACCGGC
CTGCTGACCGTGCTGGCAAGTCCGCAGGGCAGCCTGGACGAGGTCAGCGAAGCCATTCTGCAGAAGGGCG
TAGTGGCGGCCTGGGAGGCCAGGCGCAACAAAGCCCGTATCGATGACGTGGTGCTGTACATGAAATGCGA
CGTGGTCCGTGAGGAGTACGGGCAGCAGCCGACCATTATGAGCCGTATTAACGAGCTGGTGCTGCTGCTG
GACCGCTGGTGCACATGGGGAAGCGACGGTGAATACTTTAACTCCGACAAGCCGACTCTGGACGGCGAGA
CGCGCTTCACAGTGCTGGAGCTGCTCGGCCTTGAGAAACGTCCCCACCTGCTTTCTGCGGTGCTTTACTC
ACTTATTCTGGCGATCCAGGAAAAGATGTACCACTCGCCGCGCGACCTGAAAAAGGTGGCCATCATCGAC
GAAGCGTGGCGCCTGTTCAGCGGTCAGAACCCGCATGCGGCGCGCTTTATCGAAACCGGCTACCGCACGG
TGCGTCGCCACCGCGGCGCATTTGTCACCATCACGCAGGGCATTAAAGACTTTACCGGCCTGCCGGACAG
GCCGGCTCCGTCCGCCGCCGCGGCGGCATGGGACAACAGCGGTACCAAAATCACGCTGCTGCAGGAAGCG
AAAGCCTTTAAAACTTACCTCAAAGAGTGGCCGGAGCAGTTCAGCGAAATGGAAACGCAGATTATCCGCG
GCTTTGCCAAAGCCAGTCTGACGGGCTTCAGTTCCGTGATGATTTCTATGGGTGAGCAAAGTTCGTTTTA
CCGGGTGTTTGTAGACCCGGTCACGCGCGCGATGTTCAGCACCACGGGTGAAGACTACCAGTATATGACC
GAGGCGCAGAGGGCCGGGGCAACCAGCGAGGAGTCGGCGTACCTGCTGGCCTGCGAGCCGCACATGTACC
AGGCCGAAATGCAGGAGCTGGAGCGCTGGGCCGGGATTACCACCGCATAA
 Primer design