SecReT4
Protein ID: 317053802
T4SS name [ID]Tra_F [126]
Gene symbol-
Locus tagPat9b_5112
StrainPantoea sp. At-9b plasmid pPAT9B02 (NC_014839)
Repliconplasmid pPAT9B02 [GenBank: NC_014839] [Browse all T4SS(s) in this replicon]
Location [Strand]379079..379699 [+]
Producttype-F conjugative transfer system protein TraW
Component typeTraW_F
UniProt IDE6WLU5
KEGG IDpao:Pat9b_5112
PDB IDNA
Domain hit(s) vs Pfam TraW_N [PF12477], Evalue: 5.6e-05, Aligned region: 4..33
Protein Sequence: 206 a.a.     [Download]
>gi|317053802|ref|YP_004118936.1| type-F conjugative transfer system protein TraW [Pantoea sp. At-9b]
MRPRLAVLLLVLTFPLFTGAKDLGTLGHLFPIAEPDLLTFIGQRLQGMKESGELDRIQREAEARVKAHAV
RPEPVAGLTPAVKDRSFRYDPTFTVQETIRDMKGNVIARAGDRVNPLDKVPYSETLYFIDGDNPAQMRWV
KQQLTGQQNFKVILVKGNIRDSSLALDEPVYFDQYGTLTTKFGFEHTPVRVTRDDRWLRVEEVALK
 
Nucleotide Sequence: 621 bp     [Download]
>gi|317053479|ref|NC_014839.1|:379079-379699 Pantoea sp. At-9b plasmid pPAT9B02, complete sequence
ATGAGGCCCCGGCTGGCAGTGCTGCTGCTTGTCCTGACGTTCCCGCTGTTCACCGGCGCAAAAGACCTCG
GCACCCTCGGCCATCTGTTCCCGATTGCCGAGCCTGACCTGCTGACCTTTATCGGTCAGCGGCTGCAGGG
GATGAAGGAGAGCGGGGAGCTGGACAGGATACAGCGTGAGGCCGAAGCGCGGGTAAAGGCCCATGCGGTG
CGGCCTGAGCCGGTGGCGGGGCTGACGCCGGCGGTGAAAGACCGGTCATTCCGTTATGACCCGACCTTTA
CCGTGCAGGAAACCATCCGGGACATGAAGGGCAACGTCATTGCCCGGGCCGGTGACCGGGTGAACCCGCT
GGATAAGGTGCCGTACAGCGAAACGCTGTACTTCATCGACGGTGACAATCCGGCACAGATGCGCTGGGTA
AAACAGCAGCTGACCGGGCAGCAGAATTTCAAGGTCATCCTGGTGAAGGGCAATATCCGTGACAGCAGCC
TGGCGCTGGACGAGCCGGTGTACTTCGACCAGTACGGCACATTAACAACGAAATTTGGCTTTGAGCACAC
GCCGGTGCGCGTCACGCGCGATGACCGGTGGCTCAGGGTGGAGGAGGTGGCACTGAAATGA
 Primer design