SecReT4
Protein ID: 317053805
T4SS name [ID]Tra_F [126]
Gene symbol-
Locus tagPat9b_5115
StrainPantoea sp. At-9b plasmid pPAT9B02 (NC_014839)
Repliconplasmid pPAT9B02 [GenBank: NC_014839] [Browse all T4SS(s) in this replicon]
Location [Strand]380496..381488 [+]
ProductTraU family protein
Component typeTraU_F
UniProt IDE6WLU8
KEGG IDpao:Pat9b_5115
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 2.2e-77, Aligned region: 31..329
Protein Sequence: 330 a.a.     [Download]
>gi|317053805|ref|YP_004118939.1| TraU family protein [Pantoea sp. At-9b]
MKRFFLVACLLLSAMLANPVMAAASNAGDGRWVNPISDVCWKCLFPMTLGSIQLASGAHPDTPNPGSPIQ
LCPVGILYRLGLAIGFWEPMAMTDVTREPGVMVNMGGFKIDLGRTGTGRGGQSDAPTPGSFYHVHWYKYP
LIWWLNIITSVGCMQTGDMDIAYLSEVDPLWNDSTLSMIINPEVALFSNLLAQGACAADALASATGMPLD
PLFWCAGAQGSMYPFTGYTSNEFSPLEASLLVSERMAFKLHREGLVMETVGADTAVCYEYPSPIMPKSRW
RYQMVNMYPEPSDCHPFGTTTQLWGSTHNSPTSKKNFGYLMWRKRNCVFL
 
Nucleotide Sequence: 993 bp     [Download]
>gi|317053479|ref|NC_014839.1|:380496-381488 Pantoea sp. At-9b plasmid pPAT9B02, complete sequence
ATGAAGCGGTTCTTTCTTGTGGCCTGCCTGCTGCTCTCTGCCATGCTGGCAAACCCGGTCATGGCCGCGG
CCAGTAACGCCGGAGACGGTCGCTGGGTGAATCCCATCAGCGACGTCTGCTGGAAGTGCCTGTTCCCGAT
GACGCTGGGCAGCATCCAGCTGGCTTCCGGTGCGCATCCGGACACGCCAAACCCGGGGTCCCCCATTCAG
CTCTGCCCGGTGGGCATCCTTTACCGGCTGGGGCTGGCCATCGGGTTCTGGGAACCGATGGCGATGACTG
ACGTGACCCGTGAACCCGGGGTGATGGTCAATATGGGCGGCTTTAAAATCGACCTCGGCCGGACCGGTAC
CGGGCGGGGCGGGCAGAGCGATGCCCCCACACCCGGCAGCTTTTATCATGTGCACTGGTACAAGTATCCG
CTTATCTGGTGGCTGAACATCATCACCAGCGTCGGCTGCATGCAGACCGGGGACATGGATATCGCTTATC
TCTCCGAAGTGGACCCGCTCTGGAACGACAGCACGCTGTCCATGATCATTAACCCGGAGGTGGCGCTGTT
CAGTAACCTTCTGGCGCAGGGGGCCTGCGCGGCAGACGCCCTGGCGTCCGCCACGGGCATGCCGCTGGAC
CCGCTGTTCTGGTGTGCCGGTGCCCAGGGCTCGATGTACCCGTTCACGGGCTATACCAGCAATGAGTTTT
CCCCGCTGGAGGCCTCGCTGCTGGTCAGCGAACGCATGGCCTTCAAGCTGCACCGTGAGGGACTGGTGAT
GGAAACGGTGGGGGCGGATACCGCCGTCTGTTATGAGTATCCCTCCCCGATCATGCCGAAATCACGCTGG
CGCTATCAGATGGTGAACATGTACCCGGAACCCTCGGACTGTCACCCGTTCGGCACCACGACCCAGCTGT
GGGGCAGTACACACAATTCCCCGACGTCGAAAAAGAACTTCGGTTACCTCATGTGGCGCAAACGCAACTG
CGTTTTCCTCTAA
 Primer design