SecReT4
Protein ID: 317053806
T4SS name [ID]Tra_F [126]
Gene symbol-
Locus tagPat9b_5116
StrainPantoea sp. At-9b plasmid pPAT9B02 (NC_014839)
Repliconplasmid pPAT9B02 [GenBank: NC_014839] [Browse all T4SS(s) in this replicon]
Location [Strand]381498..382124 [+]
Producttype-F conjugative transfer system pilin assembly protein TrbC
Component typeTrbC_F
UniProt IDE6WLU9
KEGG IDpao:Pat9b_5116
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 5e-26, Aligned region: 91..187
Protein Sequence: 208 a.a.     [Download]
>gi|317053806|ref|YP_004118940.1| type-F conjugative transfer system pilin assembly protein TrbC [Pantoea sp. At-9b]
MKTFLITMLMLSAALLCVKAGAAQQPTVSGNDMAYMKQQQRDLELFKSQLQGMNITLPAAQQGRVAQMQN
EIAASEADQNSSSRTTPAAVYFVSLGIPEEGLLPMLADARRFGIPATLRGLLNNDFRQTAEKMFELSKKD
KQAGVQIDPTLYQQYGIKAVPALVVTCGGKFDVLYGSLPVKQALEEVRQRGDCAGTAAQLLKNGEAAR
 
Nucleotide Sequence: 627 bp     [Download]
>gi|317053479|ref|NC_014839.1|:381498-382124 Pantoea sp. At-9b plasmid pPAT9B02, complete sequence
ATGAAAACCTTTCTGATAACGATGCTGATGCTCAGCGCTGCGCTGCTGTGTGTAAAGGCGGGCGCCGCAC
AGCAGCCCACCGTGTCCGGCAATGACATGGCCTACATGAAACAGCAGCAGCGCGATCTGGAACTGTTCAA
AAGCCAGCTGCAGGGCATGAACATCACCCTGCCGGCGGCACAGCAGGGGCGGGTGGCGCAGATGCAGAAC
GAAATTGCGGCCTCTGAGGCGGACCAGAACAGCAGCAGCCGGACCACGCCGGCGGCCGTCTATTTTGTGA
GCCTGGGTATCCCGGAAGAAGGGCTGCTGCCGATGCTCGCCGACGCCCGGCGCTTCGGTATTCCGGCCAC
GCTGCGCGGACTGCTGAACAACGACTTCCGCCAGACCGCTGAAAAGATGTTTGAGCTCTCTAAAAAGGAT
AAGCAGGCGGGCGTCCAGATTGACCCGACGCTGTATCAGCAGTACGGCATTAAGGCGGTCCCGGCGCTGG
TTGTCACCTGTGGCGGAAAATTTGATGTGCTGTACGGCAGCCTGCCGGTGAAGCAGGCGCTGGAAGAGGT
CAGACAGCGCGGTGACTGTGCCGGTACGGCCGCTCAGTTGCTGAAAAACGGGGAGGCCGCCCGATGA
 Primer design