SecReT4
Protein ID: 317053807
T4SS name [ID]Tra_F [126]
Gene symbol-
Locus tagPat9b_5117
StrainPantoea sp. At-9b plasmid pPAT9B02 (NC_014839)
Repliconplasmid pPAT9B02 [GenBank: NC_014839] [Browse all T4SS(s) in this replicon]
Location [Strand]382121..383959 [+]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDE6WLV0
KEGG IDpao:Pat9b_5117
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 5.3e-55, Aligned region: 319..560
Protein Sequence: 612 a.a.     [Download]
>gi|317053807|ref|YP_004118941.1| conjugal transfer mating pair stabilization protein TraN [Pantoea sp. At-9b]
MKRLLLFLLLAVGHCAVADGVSDAYNAGAAAAASSKSQGTSAASGTDPSSVIPGYTASPSQSSYYGGVQG
GDGDISSKGQSALGQDDAGQSIISSGTTNPATTIDPTADFIQNGKNAEANSASITDGTNTQCTTKVVSKS
VFENYSCDRDVNQVQTCARTGTVTGHYEDTTTTETITIDSDSLGFNSDTLTVNWGPVPEGTVTSAVFTYT
FRKGLAYSNPVWFLNVTTLGQKLTMYDDSGSYTLASGVSLSAGDTLSFTLGNQANANNPGSIWTAGQANK
MYHFVLTLTIQKTDRKYVTDVTWSESCGFDKSTAIATDGTTCVDPGGTRTVTVDGQTYSQSADCWQYSDA
YIVPVNSTGNCATLMADRNCTVSGRSCTASEGGICLHEADTYQCQTTYSSQGLLCAGQYFCQSGDCSETD
GAGDSGFDTAVAKLAGLASAGEDVRDDQVNIKAFTGQALYCRKAMAGFSNCCVDTGWGNSAGLANCNSDE
MAIGKAKAKKVTVLVGEACNREVLGVCVQKKQAYCVFQGKLARIIQEQGRRDQLHISFGSGDSPDCRGIT
VPELQSINFDLINFQDFYSDLMANQKIPDSATMVQQAKDRIAAQVAAQTGGK
 
Nucleotide Sequence: 1839 bp     [Download]
>gi|317053479|ref|NC_014839.1|:382121-383959 Pantoea sp. At-9b plasmid pPAT9B02, complete sequence
ATGAAAAGACTGCTTCTTTTTCTGCTGCTGGCTGTGGGGCATTGCGCCGTTGCGGACGGCGTCAGTGATG
CGTACAACGCCGGCGCAGCCGCCGCGGCAAGCAGTAAAAGCCAGGGGACATCGGCGGCGTCCGGGACCGA
CCCGTCCTCGGTCATTCCCGGCTACACGGCCAGCCCTTCGCAGAGCAGTTATTACGGCGGTGTGCAGGGC
GGAGACGGCGACATCAGCTCAAAGGGCCAGTCAGCGCTCGGGCAGGATGATGCCGGTCAGAGCATCATCA
GCTCCGGCACGACCAATCCGGCGACAACGATTGACCCGACGGCGGATTTTATTCAGAACGGCAAAAATGC
CGAGGCAAACAGCGCCAGTATCACGGACGGAACGAATACGCAGTGCACCACCAAAGTCGTGTCGAAATCG
GTGTTTGAGAACTACAGCTGCGACAGGGATGTGAATCAGGTACAGACCTGCGCCCGCACGGGCACGGTAA
CGGGGCACTACGAAGACACCACGACCACGGAGACGATAACCATTGACTCGGATTCGCTGGGCTTCAACTC
AGACACGCTGACGGTAAACTGGGGGCCGGTGCCGGAAGGCACGGTGACCTCGGCCGTGTTTACCTATACG
TTCAGGAAAGGTCTGGCCTACAGCAACCCCGTCTGGTTTCTCAACGTGACCACGCTCGGCCAGAAGCTGA
CAATGTACGACGATTCCGGATCATATACCCTGGCGTCCGGGGTGAGTCTCAGTGCCGGCGATACCCTTTC
GTTCACCCTGGGCAATCAGGCCAACGCAAATAACCCCGGTTCAATCTGGACGGCGGGTCAGGCCAACAAG
ATGTATCACTTTGTGCTGACCCTCACGATACAGAAAACGGATCGTAAATATGTCACGGACGTGACCTGGT
CTGAGTCCTGCGGCTTTGATAAATCCACGGCAATCGCCACTGACGGAACCACCTGCGTCGATCCGGGAGG
GACGCGTACTGTGACGGTGGACGGGCAGACCTACAGTCAGAGCGCGGACTGCTGGCAGTATTCGGATGCG
TATATCGTCCCGGTGAACTCCACCGGCAACTGCGCCACGCTGATGGCAGACCGGAACTGCACGGTGTCCG
GGCGCAGCTGTACCGCATCGGAAGGGGGTATCTGCCTGCATGAGGCGGACACGTATCAGTGCCAGACCAC
GTACAGCTCGCAGGGGCTGCTGTGTGCAGGGCAGTATTTCTGCCAGAGCGGCGACTGCAGTGAGACTGAC
GGGGCGGGCGACAGCGGGTTTGATACTGCAGTGGCCAAACTCGCCGGGCTGGCCTCGGCCGGTGAGGACG
TCAGGGATGACCAGGTCAACATAAAGGCCTTTACCGGGCAGGCGCTGTACTGCCGCAAGGCGATGGCGGG
CTTCTCCAACTGCTGTGTGGACACCGGCTGGGGCAACAGCGCCGGGCTGGCGAACTGTAACAGCGACGAG
ATGGCCATCGGTAAAGCCAAAGCGAAAAAGGTGACGGTACTGGTCGGCGAAGCCTGTAACCGGGAGGTGC
TCGGCGTCTGCGTGCAGAAAAAGCAGGCGTACTGCGTTTTTCAGGGCAAGCTCGCGCGCATCATTCAGGA
ACAGGGGCGTCGCGACCAGCTGCACATCAGCTTCGGCAGCGGCGATTCACCCGACTGCCGCGGCATCACG
GTACCGGAGCTGCAGAGCATCAACTTCGACCTGATTAACTTCCAGGACTTCTACAGCGACCTGATGGCCA
ACCAGAAAATCCCGGACTCGGCGACGATGGTGCAGCAGGCAAAAGACCGCATTGCCGCGCAGGTGGCGGC
GCAGACGGGAGGGAAATAA
 Primer design