SecReT4
Protein ID: 317053808
T4SS name [ID]Tra_F [126]
Gene symbol-
Locus tagPat9b_5118
StrainPantoea sp. At-9b plasmid pPAT9B02 (NC_014839)
Repliconplasmid pPAT9B02 [GenBank: NC_014839] [Browse all T4SS(s) in this replicon]
Location [Strand]383959..384756 [+]
Producttype-F conjugative transfer system pilin assembly protein TraF
Component typeTraF_F
UniProt IDE6WLV1
KEGG IDpao:Pat9b_5118
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 3.6e-79, Aligned region: 38..255
Protein Sequence: 265 a.a.     [Download]
>gi|317053808|ref|YP_004118942.1| type-F conjugative transfer system pilin assembly protein TraF [Pantoea sp. At-9b]
MKNLLPALLLLVCVTGAQADETSPPADTVVTPADPFTGWHWYNEPKKKPDTPAPEPPAPRVPDFSQLSPE
KQAEVLKGYTKQALDRAILYPSAENTATFLRWQKFWTDRASMFSQSFAVAQLDHPDLDYNLEHPHYNSTA
PLQQARDQEEQTQAISRLAGQYGLFYFYRGSDPIDAQMAGVVADFARLRHISLIPVSVDGTVSPQVPDSR
QDSGQSARMGISHFPALFLVDPATKNYRPLAYGFMTQDDLAKRFLNVATGFKPNF
 
Nucleotide Sequence: 798 bp     [Download]
>gi|317053479|ref|NC_014839.1|:383959-384756 Pantoea sp. At-9b plasmid pPAT9B02, complete sequence
ATGAAAAATCTGTTACCTGCCCTGCTGCTTCTGGTCTGTGTGACCGGTGCACAGGCGGATGAAACGTCAC
CACCTGCCGATACGGTGGTAACGCCGGCCGACCCGTTTACCGGCTGGCACTGGTACAACGAGCCGAAGAA
AAAACCGGACACCCCGGCTCCGGAACCGCCGGCACCGCGTGTGCCGGACTTCAGTCAGCTTTCACCAGAG
AAGCAGGCGGAGGTGCTTAAGGGCTATACAAAACAGGCGCTGGATCGCGCCATTCTGTATCCCTCGGCGG
AAAACACGGCGACTTTCCTGCGCTGGCAGAAGTTCTGGACCGACCGCGCCTCGATGTTCAGTCAGTCGTT
CGCGGTGGCGCAGCTGGATCACCCGGACCTCGACTACAACCTGGAGCACCCGCACTACAACAGCACGGCC
CCGCTCCAGCAGGCGCGCGATCAGGAGGAGCAGACGCAGGCCATCAGCAGGCTGGCCGGGCAGTACGGTC
TGTTCTACTTCTACCGCGGCAGTGACCCGATTGATGCGCAGATGGCGGGCGTGGTGGCGGATTTTGCGCG
TCTGCGCCATATCTCCCTCATCCCGGTCAGCGTGGACGGTACCGTGTCGCCGCAGGTGCCGGACAGCCGT
CAGGACAGCGGGCAGAGCGCGCGCATGGGGATCAGCCACTTCCCTGCGCTGTTCCTGGTGGACCCTGCCA
CAAAGAATTACCGCCCGCTCGCCTACGGCTTTATGACGCAGGACGACCTGGCAAAACGTTTTCTCAACGT
GGCTACCGGCTTTAAACCCAACTTCTGA
 Primer design