SecReT4
Protein ID: 317053814
T4SS name [ID]Tra_F [126]
Gene symbol-
Locus tagPat9b_5124
StrainPantoea sp. At-9b plasmid pPAT9B02 (NC_014839)
Repliconplasmid pPAT9B02 [GenBank: NC_014839] [Browse all T4SS(s) in this replicon]
Location [Strand]387005..388372 [+]
ProductTraH family protein
Component typeTraH_F
UniProt IDE6WLV7
KEGG IDpao:Pat9b_5124
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 2.5e-114, Aligned region: 28..376
Protein Sequence: 455 a.a.     [Download]
>gi|317053814|ref|YP_004118948.1| TraH family protein [Pantoea sp. At-9b]
MKLRQFLLSVATALVISVPALADVQGDLNGYFGSLGFDGNVSKAQAWQGQAAGYVTGGSIYLRNPVKQVQ
LISMQVPSLNAGCGGIDAYLGAFSFINGAELQRFVKQIMSNAAGYAFDLALQTMVPELKQAKDFLQKLAS
DVNSMNMSSCQAAQGIIGGLWPVSQASNLKICQDIAGESNIFADWAASRQGCTVGGQGDSVTSKASDAEK
DQVLKNKNLIWDALGRNHLFDGNRQLKELVMSVVGSIIFNKDGQVTILSPLVDNRDIITVLMRGGTAKIY
GCDEADLCLGPVVTDVTVSSDVALVTQVRNLMISIDSKLSADTGLSDKEKGFINTTSVPVLKYLTNSRSM
GMSPTYLIQVADFIAQDMMIQYLQELVKQASQSLAGKNFPEQAAGELRNNVMAATSLLAQMKLQSTADQN
ALDGIDRNMQYLQQQVSTIISTSYQGNYQWGRGND
 
Nucleotide Sequence: 1368 bp     [Download]
>gi|317053479|ref|NC_014839.1|:387005-388372 Pantoea sp. At-9b plasmid pPAT9B02, complete sequence
ATGAAACTCAGGCAGTTCCTTCTTTCCGTCGCGACGGCCCTGGTCATAAGCGTACCGGCTCTGGCCGACG
TGCAGGGCGACCTGAACGGCTATTTCGGCAGCCTCGGCTTTGACGGCAACGTCTCAAAAGCGCAGGCGTG
GCAGGGGCAGGCGGCCGGTTACGTTACCGGCGGCTCCATTTATCTGCGTAACCCGGTCAAGCAGGTACAG
CTTATTTCAATGCAGGTGCCGTCACTCAATGCCGGCTGCGGCGGCATTGACGCCTATCTGGGGGCTTTTT
CCTTCATTAACGGTGCTGAACTGCAGCGGTTCGTGAAGCAGATCATGAGTAATGCCGCCGGCTATGCCTT
TGACCTGGCACTGCAGACAATGGTCCCGGAGCTAAAACAGGCCAAAGACTTCCTGCAGAAGCTGGCCTCG
GATGTCAACTCCATGAACATGAGTTCGTGTCAGGCCGCACAGGGGATCATCGGTGGCCTGTGGCCGGTGT
CCCAGGCGTCGAACCTGAAAATCTGTCAGGACATTGCCGGGGAGAGCAACATTTTTGCGGACTGGGCGGC
ATCGCGTCAGGGATGCACGGTGGGCGGTCAGGGTGACAGTGTCACCAGTAAAGCCTCTGACGCTGAAAAA
GACCAGGTGCTGAAGAACAAAAACCTCATCTGGGATGCGCTGGGGCGTAACCATCTGTTTGACGGCAACC
GGCAGCTGAAGGAGCTGGTCATGAGCGTAGTGGGCTCCATTATCTTCAACAAGGACGGGCAGGTCACCAT
CCTCTCACCGCTGGTTGATAACCGGGACATCATCACCGTGCTGATGCGCGGGGGAACCGCGAAAATCTAC
GGCTGCGACGAGGCCGACCTCTGCCTGGGTCCGGTGGTCACGGACGTGACCGTCAGCAGTGACGTCGCGC
TGGTCACGCAGGTGCGTAACCTGATGATTTCCATCGACAGCAAGCTCAGCGCAGACACCGGCCTGTCGGA
TAAGGAAAAGGGCTTTATCAACACCACCTCGGTGCCGGTGCTGAAGTATCTGACCAACTCCCGCAGCATG
GGGATGAGCCCGACCTACCTGATACAGGTGGCGGACTTTATCGCGCAGGACATGATGATCCAGTACCTGC
AGGAGCTGGTGAAGCAGGCCAGCCAGTCGCTGGCGGGTAAGAACTTCCCGGAACAGGCGGCGGGTGAACT
GCGCAACAACGTGATGGCGGCGACTTCGCTGCTGGCGCAGATGAAGCTGCAGTCCACCGCAGACCAGAAC
GCACTGGACGGCATCGACCGCAACATGCAGTACCTTCAGCAGCAGGTCTCAACCATCATCTCAACGTCTT
ATCAGGGCAACTACCAGTGGGGGCGCGGCAATGACTGA
 Primer design