SecReT4
Protein ID: 317053815
T4SS name [ID]Tra_F [126]
Gene symbol-
Locus tagPat9b_5125
StrainPantoea sp. At-9b plasmid pPAT9B02 (NC_014839)
Repliconplasmid pPAT9B02 [GenBank: NC_014839] [Browse all T4SS(s) in this replicon]
Location [Strand]388365..391496 [+]
ProductTraG domain-containing protein
Component typeTraG_F
UniProt IDE6WLV8
KEGG IDpao:Pat9b_5125
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 1.4e-114, Aligned region: 3..455
Protein Sequence: 1043 a.a.     [Download]
>gi|317053815|ref|YP_004118949.1| TraG domain-containing protein [Pantoea sp. At-9b]
MTEVWTIYGGDMWRQVFNGVVTIIGSDTFSTLKRIVGLFGVLGVMFSFIKSRNPMVFLHWVAIFFVITSV
LLVPKRSVQIIDITDPAAVYEVDNVPAGLAAIAGLATGAGFGVAQLYDYALARPDSLTYTKSGMLFGSQI
VAQSSDFRTQNPQLSQMLTDYVENCVMGDILLNNKYTVAQLLNSKDPLTLITSNPSPLRGLYQDTGGGRQ
FITCQQAAGLIQNLIGADISIGGTTWQALSTRLFGSRIDASSLLSSAMADSYDFFYAGGQSASQIMRNNV
TYAAVRDGWKGFAARSSDTANLLNLATESSLTKQRISWGAGGVIAARTLPMFQSLMMLVLIGLFPLVIAL
SLVNHSIFGLNTLKLYAGGFLYFQMWPVMFAILNSLANFYLQSKTGSTALVLANQDQVALQHSDAANIAG
YLSMSIPVLAFFLTKGAASVASQAVGGIMSSAAFATGGQASTTADGNWSFNNMSMDNVNANKFDTNMSRR
SGQQAFQTGNGSMHTQTADGHSVYDTSGAISNLPVNMRLSALASSGFSEQARQAQQEAQSSLDGYNHSVT
SGFQQMNQLTHQSGNSDSVTQGSDSTVSTNISRGASKMQSAVESYAKSHNVSEQQAYNQLMDITNQGGTG
ARGYVKFDSGDQLAGKLGKWATGLSAGGEGSVDWRHTSGSSHGTQDSHAEGRDNRHDQNSQEARDFREGV
DMVTSARLSESGSHTDNQSASQAQQFAATLNDAKSQYHQYTESSTRSQEFSRMATLSQTQSASLDANYNQ
EFVDWTTAKYGSDAQNILTNVRSAQGAATEFMHERLEPEIMRNYGARTDQVNGQPLQPTRSLDAPYMPVN
GDARVQAGSPVSGPAVPAGEHTGSIGNAREQYPTGPTAGSTEPVSGSLRQNGREVTAGESQGAVSGNGRA
TATNVQHRERNLSVPAGAPSQAMTDDFLSSSRRVSGQAAGSGIQSNVADKVAAQRSGLMETVRENDGKIA
ENKTTVQASSNILRDEHQDAVRSQQIGRTEEDLRQTKPIGDGAEIKEFKKKLENLRAAHNKAS
 
Nucleotide Sequence: 3132 bp     [Download]
>gi|317053479|ref|NC_014839.1|:388365-391496 Pantoea sp. At-9b plasmid pPAT9B02, complete sequence
ATGACTGAAGTCTGGACCATTTACGGCGGGGACATGTGGCGGCAGGTGTTTAACGGCGTGGTCACCATCA
TCGGCTCGGATACGTTCAGCACGCTGAAGCGCATCGTCGGTCTGTTCGGCGTGCTGGGTGTGATGTTCAG
TTTTATCAAATCACGCAATCCGATGGTGTTTCTGCACTGGGTGGCCATCTTTTTCGTCATCACGTCCGTG
CTGCTGGTGCCGAAGCGCAGCGTGCAGATTATTGACATCACGGACCCGGCCGCGGTGTACGAGGTGGATA
ACGTGCCGGCGGGGCTGGCTGCGATTGCCGGACTGGCGACGGGGGCCGGTTTTGGGGTGGCGCAGCTGTA
TGACTATGCGCTGGCCCGACCGGACTCACTGACCTACACGAAGTCGGGGATGCTGTTTGGCTCGCAGATT
GTGGCGCAGTCGTCTGACTTCCGCACGCAGAACCCGCAGCTGTCGCAGATGCTCACCGACTACGTGGAAA
ACTGCGTGATGGGCGATATTCTGCTGAATAACAAATACACCGTGGCGCAGCTGCTGAACAGCAAGGACCC
GCTGACGCTCATCACCAGTAATCCGAGTCCGCTGCGCGGTCTGTACCAGGATACCGGCGGCGGCCGCCAG
TTCATCACCTGCCAGCAGGCGGCGGGGCTCATTCAGAACCTGATCGGGGCGGACATCAGCATCGGGGGGA
CCACCTGGCAGGCACTTTCGACGCGACTGTTCGGCAGCCGGATTGACGCAAGCTCATTGCTCAGCAGCGC
GATGGCTGACAGCTATGACTTTTTTTACGCCGGGGGGCAGAGTGCGTCGCAGATTATGCGTAATAACGTC
ACGTATGCCGCCGTCCGAGACGGCTGGAAAGGGTTTGCGGCGCGGTCGTCCGACACGGCCAACCTGCTCA
ACCTGGCCACGGAGTCCAGCCTGACCAAACAGCGCATCAGCTGGGGGGCAGGCGGCGTGATAGCGGCCCG
TACCCTGCCGATGTTTCAGTCGCTGATGATGCTGGTGCTGATTGGCCTGTTTCCACTGGTGATTGCGCTT
TCGCTGGTCAACCACAGCATTTTCGGGCTGAACACGCTGAAGCTCTACGCCGGGGGCTTTCTCTACTTCC
AGATGTGGCCGGTAATGTTTGCCATCCTCAACTCGCTGGCCAACTTCTACCTGCAGTCGAAGACCGGCAG
CACGGCGCTGGTGCTGGCAAATCAGGATCAGGTGGCTCTGCAGCATTCGGATGCGGCAAACATCGCAGGC
TATCTCAGCATGTCGATACCGGTACTGGCGTTTTTCCTGACGAAAGGCGCGGCATCGGTGGCGTCGCAGG
CCGTGGGTGGCATCATGAGTTCGGCAGCGTTTGCGACCGGCGGACAGGCATCCACCACGGCCGACGGCAA
CTGGTCGTTTAACAACATGTCGATGGATAACGTCAACGCCAACAAGTTTGACACCAACATGAGTCGCCGG
TCCGGGCAGCAGGCGTTTCAGACCGGCAACGGCTCGATGCACACGCAGACGGCCGACGGGCACAGCGTCT
ATGACACCAGCGGGGCGATATCGAATCTGCCGGTGAACATGCGGCTCAGCGCGCTGGCCAGCAGCGGTTT
CTCCGAACAGGCGCGTCAGGCGCAGCAGGAGGCGCAGAGTTCGCTGGACGGGTATAATCACAGCGTGACC
AGCGGCTTCCAGCAGATGAACCAGCTGACGCACCAGAGCGGGAACAGCGACAGCGTGACGCAGGGCAGTG
ACAGCACCGTATCAACGAACATCAGCCGCGGCGCGAGCAAAATGCAGTCGGCGGTGGAGAGCTACGCGAA
GTCGCATAATGTCTCTGAACAGCAGGCGTATAACCAGCTGATGGATATCACTAACCAGGGGGGAACGGGT
GCCAGAGGATATGTCAAATTTGACTCCGGTGACCAGCTGGCCGGTAAACTCGGTAAGTGGGCCACCGGAC
TCAGCGCAGGTGGTGAGGGCAGCGTTGACTGGCGTCATACTTCCGGCAGCTCACACGGTACGCAGGACAG
CCACGCCGAGGGGCGCGACAACCGCCACGACCAGAACAGCCAGGAGGCGCGCGATTTCCGGGAGGGGGTG
GATATGGTCACCTCTGCCCGCCTGAGCGAATCAGGCAGCCATACCGACAATCAGTCGGCCTCGCAGGCGC
AGCAGTTTGCGGCGACGCTCAACGATGCGAAGAGTCAGTACCACCAGTACACGGAGAGCAGCACACGGAG
TCAGGAGTTCAGCCGCATGGCCACGCTGTCGCAGACGCAGAGCGCCAGCCTGGACGCCAACTACAACCAG
GAGTTTGTGGACTGGACCACGGCGAAGTACGGCAGCGATGCGCAGAACATCCTGACCAACGTCAGGAGCG
CACAGGGCGCGGCCACCGAGTTTATGCACGAGCGGCTTGAGCCGGAAATCATGCGGAACTACGGTGCGCG
GACTGACCAGGTGAACGGACAGCCGCTGCAGCCTACCCGCTCACTGGATGCACCTTATATGCCTGTGAAC
GGTGATGCACGGGTTCAGGCGGGTTCACCGGTGTCAGGACCCGCCGTACCAGCAGGGGAACATACCGGCA
GCATCGGCAACGCACGTGAGCAATATCCGACCGGTCCGACGGCGGGAAGTACAGAACCTGTGTCGGGCAG
CTTGCGGCAGAACGGTCGTGAAGTTACAGCTGGCGAATCGCAGGGGGCTGTCAGCGGAAACGGACGGGCA
ACGGCGACAAACGTTCAGCACCGTGAACGCAACCTCAGCGTGCCGGCAGGTGCACCGTCACAGGCAATGA
CGGATGACTTCCTCAGCAGTTCCCGTCGCGTGAGCGGGCAGGCCGCAGGCTCGGGTATTCAGAGTAACGT
GGCTGATAAGGTGGCAGCACAAAGATCTGGCCTGATGGAAACTGTCAGGGAAAATGACGGGAAAATCGCT
GAAAATAAAACCACTGTTCAGGCATCCAGTAATATACTCAGGGATGAGCATCAGGATGCGGTCCGGAGTC
AACAGATAGGCCGTACAGAAGAAGATTTAAGGCAGACTAAACCAATTGGGGATGGTGCCGAGATTAAAGA
GTTTAAGAAAAAACTGGAAAATCTCCGCGCAGCACATAATAAAGCTTCTTAA
 Primer design