SecReT4
Protein ID: 317054622
T4SS name [ID]Tra_I [164]
Gene symboltraL
Locus tagp3521_p033
StrainEscherichia coli plasmid p3521 (NC_014843)
Repliconplasmid p3521 [GenBank: NC_014843] [Browse all T4SS(s) in this replicon]
Location [Strand]33228..33578 [+]
ProductTraL
Component typeTraL_I
UniProt IDC1J8N3, B7LIR7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 116 a.a.     [Download]
>gi|317054622|ref|YP_004119689.1| TraL [Escherichia coli]
MNMKKTLLVILTGITLASPVAGAATCRAGAAAEAGSRAAWERARTASQAWSQRENDVASSLQSCLSRIKD
ISITLPQFPSLDKLLRDLENQVCDAVVDRVNDHLPGNIDPWKDYNL
 
Nucleotide Sequence: 351 bp     [Download]
>gi|317054589|ref|NC_014843.1|:33228-33578 Escherichia coli plasmid p3521, complete sequence
ATGAACATGAAAAAAACGCTGCTGGTCATACTGACCGGCATCACCCTGGCATCACCGGTGGCAGGTGCCG
CCACCTGCCGGGCGGGGGCCGCTGCCGAAGCCGGCAGCAGAGCCGCCTGGGAGCGGGCGCGCACAGCCAG
CCAGGCATGGTCACAGCGGGAGAATGACGTCGCCTCCTCCCTGCAGTCCTGCCTGTCCCGCATCAAGGAC
ATCAGTATCACTCTTCCGCAGTTCCCCAGCCTGGACAAGCTCCTCCGCGACCTGGAAAACCAGGTCTGTG
ATGCCGTCGTGGATCGGGTGAATGACCATCTTCCGGGGAATATCGACCCCTGGAAAGACTACAACCTCTG
A
 Primer design