SecReT4
Protein ID: 317054623
T4SS name [ID]Tra_I [164]
Gene symboltraM
Locus tagp3521_p034
StrainEscherichia coli plasmid p3521 (NC_014843)
Repliconplasmid p3521 [GenBank: NC_014843] [Browse all T4SS(s) in this replicon]
Location [Strand]33590..34285 [+]
ProductTraM
Component typeTraM_I
UniProt IDQ68JB0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmL [PF11393], Evalue: 1e-33, Aligned region: 78..185
Protein Sequence: 231 a.a.     [Download]
>gi|317054623|ref|YP_004119690.1| TraM [Escherichia coli]
MSEAHPTSPVSPEADNSGDIYNPVLRTIAQSEQRAALVPGLVRALLCSGAALCISLVANGIQYWHATGVT
REYFATDNGRLVRLAPTSQPAWSQSDVMNFGSMTLSEAFNLDFVHYRKQITTQAPRFSEAGFAGYVNALQ
ASNILDTIKKEKFNLTTTIGAGTLVNQGQMENGVWFWKFQYPVRMRLVGQTSTRPEQAFTFEITVRRVDP
RIKPGGMEISQMVSRNAAAGI
 
Nucleotide Sequence: 696 bp     [Download]
>gi|317054589|ref|NC_014843.1|:33590-34285 Escherichia coli plasmid p3521, complete sequence
ATGAGCGAAGCACACCCCACCTCCCCTGTCTCACCGGAAGCGGATAACAGCGGAGATATTTATAACCCCG
TGCTCAGAACCATCGCACAGTCAGAACAACGGGCCGCGCTGGTCCCCGGTCTGGTCAGGGCGTTGCTGTG
CAGCGGCGCAGCACTCTGCATCAGCCTGGTGGCTAATGGCATACAGTACTGGCATGCCACCGGCGTGACG
CGCGAATACTTTGCCACTGACAATGGCCGACTGGTCCGTCTGGCACCAACCAGCCAGCCGGCCTGGAGTC
AGAGCGACGTCATGAACTTTGGCAGCATGACGCTGAGCGAAGCCTTCAATCTCGATTTTGTCCACTACCG
AAAACAAATCACGACACAGGCCCCCCGCTTTTCCGAAGCCGGCTTTGCCGGCTATGTGAATGCCCTTCAG
GCCTCGAACATTCTCGACACTATTAAAAAGGAGAAATTTAACCTCACAACCACTATCGGGGCAGGTACCC
TGGTCAACCAGGGACAGATGGAGAACGGCGTCTGGTTCTGGAAATTCCAGTATCCGGTCAGGATGCGCCT
GGTCGGTCAGACCAGCACCCGCCCCGAACAGGCCTTCACCTTTGAAATCACTGTCCGGCGCGTTGACCCC
CGCATCAAACCCGGCGGCATGGAAATCAGCCAGATGGTTTCCCGTAACGCCGCAGCAGGAATCTGA
 Primer design