SecReT4
Protein ID: 317054631
T4SS name [ID]Tra_I [164]
Gene symboltraU
Locus tagp3521_p042
StrainEscherichia coli plasmid p3521 (NC_014843)
Repliconplasmid p3521 [GenBank: NC_014843] [Browse all T4SS(s) in this replicon]
Location [Strand]39608..42652 [+]
ProductTraU
Component typeTraU_I
UniProt IDE7BT99
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.5e-42, Aligned region: 502..898
Protein Sequence: 1014 a.a.     [Download]
>gi|317054631|ref|YP_004119698.1| TraU [Escherichia coli]
MNINRIIFAIEDCISTLSRYSVSAFFPDYCDLHTVIGLDQQDRERRPWLKAPYIATTKQGYYLSVFEISG
ALKEMDENPDQTAPGTLESLIAALAERMNTAWKNSGHKISFVFERDPERGRDEIEAMPLPQRKSSHARGS
CFRTSWMKKSPHSPPWLVRERCWLTVWSSEELLSRTDRKDHQTRVRKLAEHAPPARFAQDPWRWTLSALK
IRHDALLDTLEQALTHDSDGLLIRLMDIHEVGREIRRQLERNSTPAVWQPHLPEDARPAGWRQGGDTSVF
HAPSLNLQLFTTQPETHGSLIQAGELWHGMVAITLPPQNLRTFNQLVRDVPRAIPWRIRMDLMPDGMKAL
GVKKTLLTYSSFIPPLRPMYDSVMMLNDINKHDPVCIMTIVATTWGNSREVCTRNQALLKSALEGWGVCG
TTTTFGDPRRAWVNTVLAASHSSGPIPLYPPLSHALSLFPLNRAGSVWRGQGNLMMHTEDGSAWEVALAS
SQQNKHTELTPGAPGLGKSVLINALSEIQIASAQKNLPFIAYIDKGFSAQGLVQLIRDSLPEQRKDEAVG
IILSNDPDHTRNLFDVMYGARKPVTPEKNFMVSVLCALCVDTGTGQPCNPGDTRQIISSLVDLAFREYGE
NNPRLYRAGTEPLVDLALEESGIAEQHDAGWWNAATWFEIRDMLHIAGNIPAAQRAHYQAMPLLAEMSAL
LGQPSIRDVFGTVQRDNSEERLLDYIRRALDQGHSDYPMMSGCTRFMLSPDTRVVAVDLNNVAGDKTPAG
RLRTGIMYLLAGQIAGGDFVLPQYQEEIRKNLDPRYHEVIFRRIEQLDQEVKTKVYDELHNAKGINFIWE
ALDTQELEQRKFGIRTVLSTQLLQHYPPAVLKSANTLWLLRYRPDEIPFLRDNFGVPEVTLRRFLKMPEG
AAPDGSGVPVLAVFRVKNGTLARILKFTLGPLELWALNSSPKDSALRRALTQEVGSLRARQILAEHFPRG
SATSLIEHRARTHDSENVIHELAAELIRKQGYNL
 
Nucleotide Sequence: 3045 bp     [Download]
>gi|317054589|ref|NC_014843.1|:39608-42652 Escherichia coli plasmid p3521, complete sequence
ATGAATATCAACCGCATTATTTTTGCCATTGAAGACTGTATCAGTACCCTGTCACGGTATTCCGTTTCCG
CATTCTTCCCCGATTACTGTGATCTGCACACCGTCATCGGTCTGGACCAGCAGGACCGCGAACGCCGCCC
CTGGCTGAAAGCCCCCTACATTGCCACCACAAAACAGGGGTATTACCTTTCCGTCTTTGAAATCAGCGGT
GCCCTGAAAGAAATGGATGAAAACCCGGACCAGACGGCCCCCGGGACACTGGAGTCACTGATTGCAGCAC
TGGCTGAGCGAATGAACACGGCCTGGAAAAATTCCGGCCACAAAATCAGTTTTGTTTTCGAACGCGATCC
GGAGCGTGGAAGGGATGAAATCGAAGCCATGCCGTTACCCCAGCGAAAATCATCGCACGCACGGGGATCC
TGCTTCAGGACGTCCTGGATGAAAAAGTCACCACACTCACCCCCCTGGCTTGTCCGGGAGCGCTGCTGGC
TGACCGTCTGGAGCTCTGAAGAACTGCTGAGCCGGACCGATCGCAAGGACCATCAGACCCGTGTCAGGAA
ACTCGCTGAACACGCTCCGCCAGCCCGTTTTGCGCAGGATCCCTGGCGCTGGACACTTTCCGCCCTCAAA
ATACGGCATGACGCCTTACTGGACACGCTGGAGCAGGCCCTGACACATGATTCTGATGGCCTGCTGATTC
GCCTGATGGATATCCATGAAGTGGGACGGGAAATCCGCCGCCAGCTGGAGCGCAACAGTACACCGGCAGT
ATGGCAGCCTCATCTGCCTGAAGATGCCCGTCCTGCCGGCTGGCGACAGGGCGGGGATACCTCTGTATTC
CACGCACCGTCGCTGAATCTGCAGTTATTCACCACACAGCCTGAAACACACGGCAGCCTGATTCAGGCCG
GTGAGCTCTGGCACGGTATGGTCGCCATTACCCTGCCCCCTCAGAATCTGCGGACATTCAACCAGCTGGT
CAGGGATGTGCCCCGTGCAATCCCCTGGCGTATCCGGATGGATCTGATGCCCGACGGCATGAAGGCGCTG
GGGGTCAAGAAAACCCTGCTGACCTACAGCAGCTTTATTCCTCCTCTCCGGCCCATGTATGACTCGGTAA
TGATGCTGAATGACATCAACAAGCATGATCCGGTCTGTATCATGACCATTGTTGCCACCACATGGGGAAA
CAGCCGGGAAGTCTGTACCCGTAACCAGGCTCTCCTGAAATCTGCGCTGGAAGGCTGGGGGGTATGCGGC
ACCACCACAACCTTCGGTGATCCGAGACGTGCCTGGGTGAACACGGTTCTGGCAGCCTCCCACAGCTCCG
GCCCGATCCCCCTTTACCCGCCCCTTTCACACGCCCTTTCCCTGTTTCCCCTGAACAGGGCAGGCTCTGT
CTGGCGGGGACAGGGAAATCTGATGATGCACACCGAAGACGGCTCTGCATGGGAGGTGGCGCTGGCGTCA
TCACAACAGAACAAGCACACGGAGCTGACACCCGGCGCACCCGGTCTGGGCAAATCGGTACTCATCAACG
CACTGTCGGAGATCCAGATAGCCTCAGCCCAGAAGAATCTCCCTTTCATTGCCTATATCGACAAGGGATT
CAGTGCACAGGGACTGGTACAGCTTATCCGTGACAGCCTGCCTGAGCAGAGAAAGGACGAAGCCGTGGGG
ATCATTCTGAGTAATGACCCGGACCACACCCGCAACCTGTTTGATGTGATGTACGGGGCCAGAAAACCCG
TCACACCGGAAAAGAACTTCATGGTCTCCGTCCTCTGTGCATTGTGTGTGGATACCGGCACCGGTCAGCC
CTGTAATCCCGGCGACACCCGGCAAATCATCAGCAGCCTGGTGGACCTGGCCTTCCGGGAATATGGCGAG
AATAACCCCAGACTTTACCGCGCAGGTACGGAACCCCTGGTGGATCTCGCACTGGAAGAGAGCGGCATCG
CTGAACAACATGATGCCGGATGGTGGAATGCCGCCACCTGGTTTGAAATCAGGGACATGCTGCATATTGC
AGGGAATATCCCCGCCGCCCAGCGGGCACACTACCAGGCCATGCCCCTGCTGGCTGAAATGTCCGCCCTG
CTGGGACAGCCGTCCATCCGGGATGTGTTCGGCACCGTTCAGCGTGATAACTCGGAAGAGCGGTTGCTGG
ACTACATCCGCCGTGCCCTCGATCAGGGACACAGTGACTACCCGATGATGTCCGGCTGTACCCGGTTTAT
GCTCAGCCCCGACACCCGCGTGGTCGCCGTTGATCTGAACAATGTGGCCGGGGACAAGACACCTGCCGGA
CGTCTGCGCACCGGTATCATGTATCTGCTGGCCGGGCAGATCGCCGGCGGGGATTTTGTCCTGCCGCAGT
ATCAGGAGGAAATACGGAAAAATCTCGACCCACGCTACCATGAGGTGATTTTCCGCCGCATTGAACAGCT
TGATCAGGAGGTCAAGACCAAAGTCTATGACGAACTGCACAATGCAAAAGGGATCAACTTCATCTGGGAA
GCCCTGGACACCCAGGAGCTGGAGCAGCGTAAGTTCGGGATACGCACGGTGCTGAGCACCCAGCTGCTGC
AGCATTATCCTCCGGCCGTGCTCAAATCCGCCAACACCCTGTGGCTGCTGCGTTACCGCCCTGACGAAAT
TCCGTTCCTGCGGGATAACTTTGGCGTCCCGGAAGTCACCCTGCGGCGCTTCCTGAAAATGCCGGAAGGG
GCCGCACCGGACGGCAGCGGTGTCCCGGTACTGGCTGTGTTCCGTGTAAAAAACGGCACGCTGGCCCGGA
TCCTGAAATTCACCCTCGGTCCACTGGAGCTGTGGGCACTGAACTCCTCTCCTAAAGACAGCGCCCTGCG
ACGTGCGCTGACGCAGGAGGTGGGGTCACTGCGGGCACGCCAGATCCTGGCCGAACACTTTCCCCGGGGT
TCAGCCACCTCACTGATAGAACACCGCGCCCGCACACATGACAGTGAAAACGTCATCCATGAGCTGGCCG
CAGAACTCATCCGTAAGCAGGGATATAACCTCTGA
 Primer design