SecReT4
Protein ID: 319778303
T4SS name [ID]VirB [209]
Gene symbol-
Locus tagTEQUI_0117
StrainTaylorella equigenitalis MCE9
Repliconchromosome [GenBank: NC_014914] [Browse all T4SS(s) in this replicon]
Location [Strand]130277..131008 [+]
ProductPeptidoglycan hydrolase VirB1
Component typeVirB1
UniProt IDE8UDG5
KEGG IDteq:TEQUI_0117
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 8.6e-20, Aligned region: 28..157
Protein Sequence: 243 a.a.     [Download]
>gi|319778303|ref|YP_004129216.1| Peptidoglycan hydrolase VirB1 [Taylorella equigenitalis MCE9]
MKKLIYITLFLMAYSSNANANDYDDVIKSCSPNVAPETMRAIIRVESSFNPYAIGVVGGEVKQPKTLDEA
LKTVQKLKKEKLNFSMGLAQINRYNLSKYNLTEVSVFNPCSNLKASEAILSECFQRAKSEGSNDQVALQK
ALSCYFAGNFSTGFKKSKGLSYVDKIKRVALANEGFLVPKINPKVDYTPTPKGKGEFEKVKESEKVFNPK
DSNGNDDSKQKEKKYYEWDLFNDFALEGGMYMK
 
Nucleotide Sequence: 732 bp     [Download]
>gi|319778189|ref|NC_014914.1|:130277-131008 Taylorella equigenitalis MCE9 chromosome, complete genome
ATGAAAAAATTAATCTACATAACTCTTTTTTTGATGGCATATTCTAGCAATGCTAATGCAAATGACTATG
ATGATGTTATTAAATCATGTTCACCAAATGTAGCCCCAGAGACTATGAGGGCAATTATAAGAGTTGAAAG
CTCTTTTAACCCTTACGCAATTGGAGTTGTAGGCGGTGAAGTGAAACAGCCAAAAACATTAGATGAAGCC
TTAAAGACAGTGCAAAAGCTAAAAAAGGAGAAATTAAATTTCTCAATGGGTTTAGCACAAATCAATAGAT
ATAACCTCTCTAAATATAACTTAACGGAAGTATCAGTTTTTAACCCATGCTCAAATCTAAAAGCTAGCGA
AGCAATTTTAAGTGAGTGTTTTCAAAGGGCTAAAAGCGAAGGTAGCAACGATCAAGTAGCTTTACAAAAA
GCTTTAAGTTGTTATTTTGCAGGCAATTTTTCTACTGGGTTTAAAAAATCTAAAGGCTTAAGTTATGTAG
ATAAGATTAAAAGAGTAGCCCTTGCTAATGAAGGATTTCTGGTTCCTAAAATCAATCCTAAAGTTGATTA
CACACCTACCCCAAAAGGCAAAGGTGAGTTTGAGAAAGTAAAAGAGAGTGAAAAAGTTTTTAATCCTAAA
GACTCTAATGGTAATGATGATAGTAAGCAAAAAGAGAAAAAATACTATGAGTGGGATTTATTTAACGATT
TTGCACTAGAAGGGGGAATGTATATGAAATAA
 Primer design