SecReT4
Protein ID: 319778304
T4SS name [ID]VirB [209]
Gene symbol-
Locus tagTEQUI_0118
StrainTaylorella equigenitalis MCE9
Repliconchromosome [GenBank: NC_014914] [Browse all T4SS(s) in this replicon]
Location [Strand]131119..131415 [+]
Producthypothetical protein
Component typeVirB2
UniProt IDE8UDG6
KEGG IDteq:TEQUI_0118
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 98 a.a.     [Download]
>gi|319778304|ref|YP_004129217.1| hypothetical protein TEQUI_0118 [Taylorella equigenitalis MCE9]
MKKFLNLLVIIVLGGLSTVAYSAGFGDAVAGKMEELRKAILIVVGVVATIALLWQMAEGFMGKKTWPDVF
QTCLWILGAGAAVAIANWVFTTGQGISF
 
Nucleotide Sequence: 297 bp     [Download]
>gi|319778189|ref|NC_014914.1|:131119-131415 Taylorella equigenitalis MCE9 chromosome, complete genome
ATGAAAAAGTTTTTAAATTTATTAGTAATTATTGTGCTTGGCGGTTTGAGTACTGTAGCTTATTCAGCAG
GCTTCGGAGACGCCGTTGCAGGCAAAATGGAAGAGCTTCGTAAAGCAATTTTAATAGTAGTAGGTGTGGT
AGCAACTATTGCGCTTTTATGGCAAATGGCTGAGGGTTTTATGGGTAAAAAGACATGGCCTGATGTGTTT
CAAACATGCTTATGGATTTTAGGTGCAGGTGCTGCTGTAGCAATTGCTAACTGGGTATTTACAACTGGAC
AAGGAATTAGTTTCTAA
 Primer design