SecReT4
Protein ID: 319778305
T4SS name [ID]VirB [209]
Gene symbol-
Locus tagTEQUI_0119
StrainTaylorella equigenitalis MCE9
Repliconchromosome [GenBank: NC_014914] [Browse all T4SS(s) in this replicon]
Location [Strand]131740..134145 [+]
ProductVirB4 ATPase like protein
Component typeVirB4
UniProt IDE8UDG7
KEGG IDteq:TEQUI_0119
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.7e-29, Aligned region: 428..708
CagE_TrbE_VirB [PF03135], Evalue: 2.1e-26, Aligned region: 162..357
Protein Sequence: 801 a.a.     [Download]
>gi|319778305|ref|YP_004129218.1| VirB4 ATPase like protein [Taylorella equigenitalis MCE9]
MITADWLKNILNKQTAHVDYLPKISHHVTPELISYEDGYLAWVIQVDGMPFESQNNSHIITHFEQLNNLL
TAIGKTTGNRLALWTTLQRKKRQFEREYSVDNLFTNEFLSKYVEKFKESSYFSNYFYITGVLKIDDIDEG
IKEANELIALMLNGLQAYTPTLLKAYTEEDVMFSEIWEFFATLINYKHEQIPETHISQKNVIGNTDLHFG
TDVCQLRTQSETLYCVSFDLKDFGISKPKILVDILNLPFEFTLTQSFVFVNSAEMQGVIDKQLNNLVSAG
DLAIHQQEELLYGKGFLSAGELMFGEYHSCLVVYGESPSVASQNGSKAVSRFLNAGGFRFTKAGLSAPAT
YFSQIPKSPLRPRKYPKTTQNLATTFGMHNYSAGKEIGNPIGDGTAIMPLKTVSNTIYDFNFHYSNVNED
NLGDKIAGHTLILGATGTGKTTLETSLLTFTNRFNPYLFVMDLDEGMKIFLSALGGTYFTFEEGKPTGLN
PFQIEDTPANREFLYTLVGVCGRNVDGTVTADEEGQIKLAVDTLFNIIDFENRNFSTLLQSIPYQNENPN
SLRTRLSKWCRSTDGRFSWCLDNETNIFNHHEFTKIGFDLTDILQDKYPPTEPVLLYLFYLRSLMMERVA
KEDGILCTVIEEFWYPLRFSTTSELILKMLKTDRKLGGWCVLTSQSPEDAITSDIFPAIVQQTPTKVFLP
NPDAVYEGRYEFVGITRKEFDELVKLSLDSRTFLVKQSKQSAFAKLDLYGFSDEMAVLSGNSANNELLDE
IIKRVDSKNPDVWYPIFKETINERRKAKKLI
 
Nucleotide Sequence: 2406 bp     [Download]
>gi|319778189|ref|NC_014914.1|:131740-134145 Taylorella equigenitalis MCE9 chromosome, complete genome
ATGATTACAGCAGACTGGTTAAAGAATATTTTGAACAAGCAAACCGCGCACGTAGATTACTTGCCAAAAA
TAAGCCATCACGTAACACCCGAATTAATTAGCTATGAAGATGGCTACTTGGCTTGGGTTATACAAGTAGA
TGGTATGCCGTTTGAAAGCCAAAACAATAGTCATATCATTACTCACTTTGAACAACTTAATAATTTACTA
ACAGCAATTGGTAAAACAACAGGTAATCGCTTAGCACTTTGGACTACGCTTCAAAGAAAAAAAAGGCAGT
TTGAAAGAGAGTACTCGGTTGATAATTTATTCACAAATGAGTTTCTTAGTAAGTATGTTGAGAAATTTAA
AGAAAGTAGTTACTTTAGTAATTACTTTTACATAACTGGTGTTTTAAAGATTGATGATATAGACGAAGGT
ATAAAAGAGGCTAACGAGTTGATTGCTTTAATGCTTAATGGACTTCAAGCTTATACCCCTACTCTTTTAA
AAGCGTACACAGAAGAAGATGTAATGTTCTCTGAAATATGGGAATTCTTTGCAACTCTTATAAATTACAA
ACACGAGCAAATACCAGAGACACACATTTCACAAAAAAATGTTATTGGTAATACGGATTTGCATTTTGGA
ACTGATGTATGTCAGTTAAGAACCCAAAGTGAAACCTTATATTGCGTATCGTTTGATTTAAAAGATTTTG
GGATAAGCAAACCTAAAATCTTGGTAGATATTCTTAATTTGCCATTTGAATTTACACTGACTCAAAGTTT
TGTGTTTGTGAATTCTGCTGAAATGCAAGGTGTTATAGATAAACAGCTTAATAACTTAGTCTCAGCGGGA
GACTTAGCTATTCATCAACAAGAAGAGTTACTTTACGGAAAAGGGTTTTTAAGTGCGGGCGAATTAATGT
TTGGTGAGTATCACTCATGCCTAGTGGTTTATGGTGAATCGCCTTCTGTTGCCTCACAAAATGGTTCAAA
AGCGGTATCACGATTTTTAAATGCAGGAGGCTTTAGGTTTACAAAAGCAGGCTTATCCGCCCCCGCAACT
TATTTTTCACAAATTCCGAAAAGTCCGCTAAGACCAAGAAAGTATCCGAAGACTACGCAAAATCTTGCCA
CAACATTCGGAATGCACAATTATTCAGCGGGTAAAGAAATAGGTAATCCGATAGGCGATGGCACAGCGAT
TATGCCCTTAAAAACTGTATCTAACACAATCTATGATTTTAACTTTCACTACTCTAATGTGAATGAAGAT
AATCTAGGCGATAAGATAGCAGGCCACACACTGATTTTAGGAGCAACTGGTACTGGTAAAACAACGCTTG
AGACATCTCTTCTTACGTTTACAAATAGATTTAATCCTTATTTATTTGTGATGGATTTGGATGAGGGTAT
GAAAATCTTTTTAAGTGCTTTAGGCGGTACATACTTTACTTTTGAAGAAGGAAAGCCAACTGGGCTAAAC
CCATTTCAGATAGAGGATACCCCAGCAAATAGAGAGTTTTTATATACACTTGTAGGAGTATGTGGACGTA
ATGTTGATGGTACAGTTACAGCTGATGAAGAAGGACAGATTAAATTAGCAGTGGATACGCTATTTAACAT
AATTGATTTTGAAAATCGTAATTTTTCAACTCTTTTGCAGTCAATCCCTTATCAAAACGAAAACCCTAAT
TCGCTAAGAACAAGGTTATCAAAGTGGTGTAGAAGTACAGATGGACGATTTTCATGGTGTTTAGATAATG
AAACCAATATCTTTAATCATCATGAATTTACAAAGATAGGTTTTGATTTAACAGATATTTTGCAAGATAA
ATATCCCCCTACAGAACCAGTTTTACTTTATCTATTCTATTTAAGATCACTTATGATGGAAAGGGTAGCT
AAAGAAGACGGGATTCTTTGTACTGTGATTGAAGAGTTTTGGTATCCATTACGATTTAGCACAACTTCAG
AATTAATTTTAAAAATGCTTAAGACAGATAGGAAATTGGGAGGTTGGTGTGTATTAACGTCCCAATCGCC
TGAAGACGCAATTACTAGCGATATCTTTCCAGCAATAGTTCAACAAACCCCGACTAAGGTTTTCTTGCCA
AATCCAGACGCTGTTTATGAAGGGCGTTATGAGTTTGTAGGAATAACACGAAAAGAGTTTGACGAGCTTG
TTAAGCTATCTTTAGATAGTAGAACATTCTTAGTAAAACAATCTAAACAATCGGCTTTTGCAAAGCTAGA
TTTATATGGCTTTAGTGATGAGATGGCAGTATTAAGTGGAAATAGTGCCAACAACGAATTGTTAGATGAG
ATTATTAAGAGAGTGGATTCAAAAAATCCTGATGTTTGGTATCCAATATTTAAAGAGACAATTAATGAGA
GAAGGAAAGCTAAAAAGCTAATTTAG
 Primer design