SecReT4
Protein ID: 319778318
T4SS name [ID]VirB [209]
Gene symbol-
Locus tagTEQUI_0132
StrainTaylorella equigenitalis MCE9
Repliconchromosome [GenBank: NC_014914] [Browse all T4SS(s) in this replicon]
Location [Strand]141734..142363 [+]
ProductMinor pilin of type IV secretion complex, VirB5
Component typeVirB5
UniProt IDE8UDI0
KEGG IDteq:TEQUI_0132
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 9.7e-32, Aligned region: 23..192
Protein Sequence: 209 a.a.     [Download]
>gi|319778318|ref|YP_004129231.1| Minor pilin of type IV secretion complex, VirB5 [Taylorella equigenitalis MCE9]
MKLSKLFLYTVLSVGFANVHAGGIPVIDTAQLTQEAQNFLKSLAEMKNQVENQIKQITELKAQVSALTSQ
RGLGNVLRDELKSNIPDSWKEMYGKVGNLDILKGENFDPEGSAKNLVAMLEGTEKSFDSIKERMKKIDEL
TNLINTTKDIKETGDLQARIQSEQLAITNEQIKLDQLARAYEIQKEVNSKQRIRQETCSLAKWAGRTCE
 
Nucleotide Sequence: 630 bp     [Download]
>gi|319778189|ref|NC_014914.1|:141734-142363 Taylorella equigenitalis MCE9 chromosome, complete genome
ATGAAATTGTCTAAATTATTTTTATATACTGTATTAAGTGTAGGATTTGCCAATGTACACGCTGGAGGTA
TTCCTGTAATTGATACCGCCCAGTTAACCCAAGAGGCACAAAACTTTCTTAAATCTCTAGCAGAGATGAA
AAATCAAGTTGAAAACCAAATTAAACAAATTACCGAACTTAAAGCACAAGTCAGTGCTTTAACAAGCCAA
AGAGGCCTAGGTAATGTATTGCGTGATGAGTTAAAGTCTAATATTCCTGATTCTTGGAAAGAAATGTATG
GAAAAGTAGGCAATTTAGATATTCTTAAAGGTGAAAACTTTGATCCAGAAGGTTCTGCTAAAAACCTAGT
AGCAATGCTTGAGGGGACTGAAAAATCATTCGATTCAATCAAAGAAAGAATGAAGAAAATTGATGAACTT
ACCAATTTAATTAATACAACTAAAGATATTAAGGAAACTGGTGACTTACAAGCACGTATTCAATCCGAAC
AATTAGCTATAACTAATGAACAAATTAAATTGGACCAATTAGCAAGAGCTTATGAAATTCAAAAAGAAGT
TAATTCAAAACAAAGAATTCGTCAAGAAACTTGTAGCTTAGCTAAATGGGCAGGGCGAACTTGCGAATAG
 Primer design