SecReT4
Protein ID: 319778319
T4SS name [ID]VirB [209]
Gene symbol-
Locus tagTEQUI_0133
StrainTaylorella equigenitalis MCE9
Repliconchromosome [GenBank: NC_014914] [Browse all T4SS(s) in this replicon]
Location [Strand]142372..143496 [+]
ProductInner membrane protein of type IV secretion of T-DNA complex, VirB6
Component typeVirB6
UniProt IDE8UDI1
KEGG IDteq:TEQUI_0133
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 7e-28, Aligned region: 38..272
Protein Sequence: 374 a.a.     [Download]
>gi|319778319|ref|YP_004129232.1| Inner membrane protein of type IV secretion of T-DNA complex, VirB6 [Taylorella equigenitalis MCE9]
MEFVQRIFDFITTAMSSGLYNRANNIITNVVYAFSMGFTIYMLYVIWDFYQRGVDASLMDFTRKVFGWLL
IIAIAFNGPNYQTIATYLYELPESLVGWINGTPMDAKYFTEMVTVINQNISNLQAQQDSAGWATKVLIGI
SMGIVMLLGYGGLFLTIGMYLIAKASLAVILTLGPIFIGFLLFSNTRQWGMNWISQILNYSITIGLYSII
IVIQQDTMKGLKLTNKVENHWFWGESTAVNLGDIMNFTLAIIAISAILIPVIMSIPSIASALVGGASASS
QTGGFGRMAMAGATGAGTGAGAVLSRGAGMALRSANWTSGGTLGKAGNALINSGLAHKAVGVAKATKGFF
RDGGGRRLGHKSALEKSRMNNPSN
 
Nucleotide Sequence: 1125 bp     [Download]
>gi|319778189|ref|NC_014914.1|:142372-143496 Taylorella equigenitalis MCE9 chromosome, complete genome
ATGGAATTTGTTCAAAGAATTTTTGACTTTATTACGACTGCTATGAGTAGCGGTTTGTACAATAGAGCCA
ATAACATAATTACAAATGTTGTTTACGCTTTCTCAATGGGTTTTACTATATACATGCTTTATGTTATATG
GGATTTTTACCAAAGAGGCGTTGACGCTTCTTTAATGGATTTTACTAGGAAAGTTTTTGGTTGGTTATTA
ATTATTGCTATTGCTTTTAATGGTCCTAATTATCAAACCATTGCAACTTATCTTTATGAATTACCCGAAT
CTCTTGTTGGTTGGATAAATGGCACACCTATGGACGCAAAATATTTTACTGAAATGGTGACTGTTATTAA
TCAAAATATATCAAACCTTCAAGCACAACAAGATTCAGCAGGTTGGGCTACAAAAGTTTTGATTGGTATA
AGCATGGGTATTGTAATGTTATTAGGTTATGGTGGATTATTTTTAACAATAGGCATGTATTTAATAGCTA
AAGCAAGTCTAGCTGTAATTCTAACTTTAGGTCCTATATTCATTGGTTTTCTCTTGTTTAGTAATACTAG
ACAATGGGGTATGAATTGGATAAGTCAAATATTAAACTACTCTATAACCATAGGATTGTACTCAATAATA
ATTGTTATTCAACAAGATACAATGAAAGGGCTAAAACTCACAAATAAAGTTGAAAATCATTGGTTTTGGG
GTGAATCAACTGCAGTAAATCTAGGCGATATTATGAATTTTACCTTAGCCATAATAGCTATTAGTGCTAT
TTTAATTCCAGTGATAATGTCAATTCCATCTATAGCAAGTGCTTTAGTAGGTGGTGCCAGTGCTTCTAGT
CAAACTGGTGGATTTGGAAGAATGGCAATGGCAGGTGCTACTGGTGCAGGCACAGGTGCTGGTGCGGTGT
TAAGTCGTGGAGCAGGTATGGCACTACGAAGTGCTAACTGGACAAGTGGAGGAACTCTTGGTAAAGCTGG
TAATGCACTAATAAATTCTGGTTTAGCTCATAAAGCCGTAGGCGTAGCTAAAGCTACTAAAGGTTTCTTT
AGGGACGGAGGAGGAAGGCGTTTAGGTCATAAATCCGCCTTAGAGAAATCACGAATGAATAATCCATCTA
ATTAA
 Primer design