SecReT4
Protein ID: 319778326
T4SS name [ID]VirB [209]
Gene symbol-
Locus tagTEQUI_0140
StrainTaylorella equigenitalis MCE9
Repliconchromosome [GenBank: NC_014914] [Browse all T4SS(s) in this replicon]
Location [Strand]147962..148672 [+]
ProductInner membraney-like protein
Component typeVirB8
UniProt IDE8UDI8
KEGG IDteq:TEQUI_0140
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.1e-57, Aligned region: 28..235
Protein Sequence: 236 a.a.     [Download]
>gi|319778326|ref|YP_004129239.1| Inner membraney-like protein [Taylorella equigenitalis MCE9]
MRKRKDNKVTNTPNANANAIANKMIESAKEFEKSKIKGVKAMSRVAWTITALSMVMTALAICAVMLLTPL
KTVEPYVVRVDNNTGHTDIVYALDEQKIDKKEAMDRYWLKNYVIFREGYDWYTVQANYDTTIVFSGEKEQ
KRIQQFFLSDVAPYKVFKNDFRVDVKITSISYVGDVAQVRFQRQMYDLRDPTKEPTTQKLIATIGYEYAK
RKLSHDDSLINPLGFTVGSYTVDTEN
 
Nucleotide Sequence: 711 bp     [Download]
>gi|319778189|ref|NC_014914.1|:147962-148672 Taylorella equigenitalis MCE9 chromosome, complete genome
ATGAGAAAGAGAAAAGATAACAAAGTAACTAACACACCAAATGCCAATGCAAATGCGATAGCAAATAAGA
TGATTGAAAGTGCTAAGGAATTTGAAAAATCCAAAATCAAAGGCGTAAAAGCAATGAGTAGAGTTGCATG
GACGATTACAGCATTAAGCATGGTAATGACGGCACTTGCAATATGTGCGGTTATGCTACTAACCCCTCTT
AAAACGGTAGAGCCATATGTTGTTAGAGTTGATAACAACACAGGGCATACGGATATTGTTTATGCCTTAG
ATGAGCAAAAGATAGACAAAAAAGAAGCAATGGATAGGTACTGGTTGAAAAACTATGTAATTTTCAGAGA
GGGTTATGACTGGTATACGGTGCAAGCCAATTACGATACAACAATAGTGTTTAGTGGTGAAAAAGAACAA
AAGAGAATACAGCAGTTTTTCTTATCAGATGTAGCCCCTTACAAGGTGTTTAAAAATGATTTTAGGGTAG
ATGTGAAAATAACCTCTATATCATACGTTGGAGATGTAGCCCAAGTGAGATTTCAAAGGCAAATGTATGA
TTTGCGAGATCCAACAAAAGAGCCAACAACACAAAAGTTAATAGCAACTATTGGCTATGAGTATGCCAAA
CGTAAGTTATCCCATGACGATAGCTTAATAAACCCTTTAGGGTTTACGGTTGGGAGTTACACAGTAGATA
CAGAGAATTAA
 Primer design